Recombinant Human LITAF protein, GST-tagged

• Cat.No.: LITAF-3178H
• Product Overview: Recombinant Human LITAF protein(Q99732)(1-161aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-161aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.1 kDa
• AA Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: LITAF lipopolysaccharide-induced TNF factor [ Homo sapiens ]
• Official Symbol: LITAF
• Synonyms: LITAF; lipopolysaccharide-induced TNF factor; lipopolysaccharide-induced tumor necrosis factor-alpha factor; FLJ38636; PIG7; SIMPLE; TP53I7; p53-induced gene 7 protein; LPS-induced TNF-alpha factor; tumor protein p53 inducible protein 7; lipopolysaccharide-induced TNF-alpha factor; small integral membrane protein of lysosome/late endosome; MGC116698; MGC116700; MGC116701; MGC125274; MGC125275; MGC125276
• Gene ID: 9516
• mRNA Refseq: NM_001136472
• Protein Refseq: NP_001129944
• MIM: 603795
• UniProt ID: Q99732