Recombinant Human LITAF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LITAF-5641H |
Product Overview : | LITAF MS Standard C13 and N15-labeled recombinant protein (NP_004853) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LITAF lipopolysaccharide-induced TNF factor [ Homo sapiens (human) ] |
Official Symbol | LITAF |
Synonyms | LITAF; lipopolysaccharide-induced TNF factor; lipopolysaccharide-induced tumor necrosis factor-alpha factor; FLJ38636; PIG7; SIMPLE; TP53I7; p53-induced gene 7 protein; LPS-induced TNF-alpha factor; tumor protein p53 inducible protein 7; lipopolysaccharide-induced TNF-alpha factor; small integral membrane protein of lysosome/late endosome; MGC116698; MGC116700; MGC116701; MGC125274; MGC125275; MGC125276; |
Gene ID | 9516 |
mRNA Refseq | NM_004862 |
Protein Refseq | NP_004853 |
MIM | 603795 |
UniProt ID | Q99732 |
◆ Recombinant Proteins | ||
LITAF-5840C | Recombinant Chicken LITAF | +Inquiry |
LITAF-2525R | Recombinant Rhesus monkey LITAF Protein, His-tagged | +Inquiry |
Litaf-3792M | Recombinant Mouse Litaf Protein, Myc/DDK-tagged | +Inquiry |
LITAF-9138M | Recombinant Mouse LITAF Protein | +Inquiry |
LITAF-560C | Recombinant Chicken LITAF protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LITAF-4722HCL | Recombinant Human LITAF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LITAF Products
Required fields are marked with *
My Review for All LITAF Products
Required fields are marked with *