Recombinant Human LITAF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LITAF-5641H
Product Overview : LITAF MS Standard C13 and N15-labeled recombinant protein (NP_004853) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 17.1 kDa
AA Sequence : MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LITAF lipopolysaccharide-induced TNF factor [ Homo sapiens (human) ]
Official Symbol LITAF
Synonyms LITAF; lipopolysaccharide-induced TNF factor; lipopolysaccharide-induced tumor necrosis factor-alpha factor; FLJ38636; PIG7; SIMPLE; TP53I7; p53-induced gene 7 protein; LPS-induced TNF-alpha factor; tumor protein p53 inducible protein 7; lipopolysaccharide-induced TNF-alpha factor; small integral membrane protein of lysosome/late endosome; MGC116698; MGC116700; MGC116701; MGC125274; MGC125275; MGC125276;
Gene ID 9516
mRNA Refseq NM_004862
Protein Refseq NP_004853
MIM 603795
UniProt ID Q99732

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LITAF Products

Required fields are marked with *

My Review for All LITAF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon