Recombinant Human LMCD1 protein, His-tagged
| Cat.No. : | LMCD1-3292H |
| Product Overview : | Recombinant Human LMCD1 protein(1-365 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 04, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-365 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LMCD1 LIM and cysteine-rich domains 1 [ Homo sapiens ] |
| Official Symbol | LMCD1 |
| Synonyms | LMCD1; LIM and cysteine-rich domains 1; LIM and cysteine-rich domains protein 1; dyxin; |
| Gene ID | 29995 |
| mRNA Refseq | NM_014583 |
| Protein Refseq | NP_055398 |
| MIM | 604859 |
| UniProt ID | Q9NZU5 |
| ◆ Recombinant Proteins | ||
| LMCD1-1966HFL | Recombinant Full Length Human LMCD1 Protein, C-Flag-tagged | +Inquiry |
| LMCD1-4233H | Recombinant Human LMCD1 Protein (Met1-Ser365), C-His tagged | +Inquiry |
| LMCD1-3292H | Recombinant Human LMCD1 protein, His-tagged | +Inquiry |
| LMCD1-2936H | Recombinant Human LIM And Cysteine-rich Domains 1, T7-tagged | +Inquiry |
| LMCD1-11296Z | Recombinant Zebrafish LMCD1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LMCD1-4715HCL | Recombinant Human LMCD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMCD1 Products
Required fields are marked with *
My Review for All LMCD1 Products
Required fields are marked with *
