Recombinant Human LMNB1 protein, GST-tagged
| Cat.No. : | LMNB1-301578H |
| Product Overview : | Recombinant Human LMNB1 (237-587 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Glu237-Met587 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | LMNB1 lamin B1 [ Homo sapiens ] |
| Official Symbol | LMNB1 |
| Synonyms | LMNB1; lamin B1; lamin-B1; LMN; ADLD; LMN2; LMNB; MGC111419; |
| Gene ID | 4001 |
| mRNA Refseq | NM_001198557 |
| Protein Refseq | NP_001185486 |
| MIM | 150340 |
| UniProt ID | P20700 |
| ◆ Recombinant Proteins | ||
| LMNB1-266H | Recombinant Human LMNB1 protein, His-tagged | +Inquiry |
| LMNB1-3084R | Recombinant Rat LMNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LMNB1-6274HFL | Recombinant Full Length Human LMNB1 protein, Flag-tagged | +Inquiry |
| LMNB1-301578H | Recombinant Human LMNB1 protein, GST-tagged | +Inquiry |
| LMNB1-260H | Recombinant Human LMNB1 protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LMNB1-994HCL | Recombinant Human LMNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMNB1 Products
Required fields are marked with *
My Review for All LMNB1 Products
Required fields are marked with *



