Recombinant Full Length Human LMO4 Protein, His tagged

• Cat.No.: LMO4-27549TH
• Product Overview: Recombinant Full Length Human LMO4 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-165 aa
• Description: This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene.
• Tag: His
• Molecular Mass: 18 kDa
• AA Sequence: MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
• Endotoxin: <2 EU/μg by LAL
• Purity: > 85% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 1 mg/mL

Gene Information

• Gene Name: LMO4 LIM domain only 4 [ Homo sapiens (human) ]
• Official Symbol: LMO4
• Synonyms: LMO4; LIM domain only 4; LIM domain transcription factor LMO4; LMO-4; breast tumor autoantigen; LIM domain only protein 4
• Gene ID: 8543
• mRNA Refseq: NM_006769
• Protein Refseq: NP_006760
• MIM: 603129
• UniProt ID: P61968