Recombinant Full Length Human LMO4 Protein, His tagged

Cat.No. : LMO4-27549TH
Product Overview : Recombinant Full Length Human LMO4 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-165 aa
Description : This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene.
Tag : His
Molecular Mass : 18 kDa
AA Sequence : MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Endotoxin : <2 EU/μg by LAL
Purity : > 85% by SDS-PAGE
Storage : Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1 mg/mL
Gene Name LMO4 LIM domain only 4 [ Homo sapiens (human) ]
Official Symbol LMO4
Synonyms LMO4; LIM domain only 4; LIM domain transcription factor LMO4; LMO-4; breast tumor autoantigen; LIM domain only protein 4;
Gene ID 8543
mRNA Refseq NM_006769
Protein Refseq NP_006760
MIM 603129
UniProt ID P61968

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LMO4 Products

Required fields are marked with *

My Review for All LMO4 Products

Required fields are marked with *

0
cart-icon
0
compare icon