Recombinant Human LMO4 protein, GST-tagged
Cat.No. : | LMO4-3179H |
Product Overview : | Recombinant Human LMO4 protein(P61968)(1-165aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-165aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45 kDa |
AA Sequence : | MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LMO4 LIM domain only 4 [ Homo sapiens ] |
Official Symbol | LMO4 |
Synonyms | LMO4; LIM domain only 4; LIM domain transcription factor LMO4; LMO-4; breast tumor autoantigen; LIM domain only protein 4; |
Gene ID | 8543 |
mRNA Refseq | NM_006769 |
Protein Refseq | NP_006760 |
MIM | 603129 |
UniProt ID | P61968 |
◆ Recombinant Proteins | ||
LMO4-2356R | Recombinant Rhesus Macaque LMO4 Protein, His (Fc)-Avi-tagged | +Inquiry |
LMO4-2937H | Recombinant Human LIM Domain Only 4, T7-tagged | +Inquiry |
LMO4-2536R | Recombinant Rhesus monkey LMO4 Protein, His-tagged | +Inquiry |
LMO4-3179H | Recombinant Human LMO4 protein, GST-tagged | +Inquiry |
LMO4-5688C | Recombinant Chicken LMO4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMO4-4707HCL | Recombinant Human LMO4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMO4 Products
Required fields are marked with *
My Review for All LMO4 Products
Required fields are marked with *