Recombinant Full Length Human LMO4 Protein, C-Flag-tagged
Cat.No. : | LMO4-772HFL |
Product Overview : | Recombinant Full Length Human LMO4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD RPTALINGHLNSLQSNPLLPDQKVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | LMO4 LIM domain only 4 [ Homo sapiens (human) ] |
Official Symbol | LMO4 |
Synonyms | LIM domain only 4; OTTHUMP00000011905; OTTHUMP00000011906 |
Gene ID | 8543 |
mRNA Refseq | NM_006769.4 |
Protein Refseq | NP_006760.1 |
MIM | 603129 |
UniProt ID | P61968 |
◆ Recombinant Proteins | ||
LMO4-3179H | Recombinant Human LMO4 protein, GST-tagged | +Inquiry |
LMO4-1307H | Recombinant Human LMO4 Protein, His (Fc)-Avi-tagged | +Inquiry |
LMO4-2800H | Recombinant Human LMO4 protein(21-150 aa), N-MBP & C-His-tagged | +Inquiry |
LMO4-2937H | Recombinant Human LIM Domain Only 4, T7-tagged | +Inquiry |
LMO4-772HFL | Recombinant Full Length Human LMO4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMO4-4707HCL | Recombinant Human LMO4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LMO4 Products
Required fields are marked with *
My Review for All LMO4 Products
Required fields are marked with *
0
Inquiry Basket