Recombinant Full Length Human LMO4 Protein, C-Flag-tagged

Cat.No. : LMO4-772HFL
Product Overview : Recombinant Full Length Human LMO4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 17.8 kDa
AA Sequence : MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD
RPTALINGHLNSLQSNPLLPDQKVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transcription Factors
Full Length : Full L.
Gene Name LMO4 LIM domain only 4 [ Homo sapiens (human) ]
Official Symbol LMO4
Synonyms LIM domain only 4; OTTHUMP00000011905; OTTHUMP00000011906
Gene ID 8543
mRNA Refseq NM_006769.4
Protein Refseq NP_006760.1
MIM 603129
UniProt ID P61968

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LMO4 Products

Required fields are marked with *

My Review for All LMO4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon