Recombinant Human LMO4 protein(21-150 aa), N-MBP & C-His-tagged

Cat.No. : LMO4-2800H
Product Overview : Recombinant Human LMO4 protein(P61968)(21-150 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&MBP
Protein Length : 21-150 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHL
Gene Name LMO4 LIM domain only 4 [ Homo sapiens ]
Official Symbol LMO4
Synonyms LMO4; LIM domain only 4; LIM domain transcription factor LMO4; LMO-4; breast tumor autoantigen; LIM domain only protein 4;
Gene ID 8543
mRNA Refseq NM_006769
Protein Refseq NP_006760
MIM 603129
UniProt ID P61968

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LMO4 Products

Required fields are marked with *

My Review for All LMO4 Products

Required fields are marked with *

0
cart-icon
0
compare icon