Recombinant Human LMO4 protein(21-150 aa), N-MBP & C-His-tagged

• Cat.No.: LMO4-2800H
• Product Overview: Recombinant Human LMO4 protein(P61968)(21-150 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&MBP
• Protein Length: 21-150 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHL

Gene Information

• Gene Name: LMO4 LIM domain only 4 [ Homo sapiens ]
• Official Symbol: LMO4
• Synonyms: LMO4; LIM domain only 4; LIM domain transcription factor LMO4; LMO-4; breast tumor autoantigen; LIM domain only protein 4
• Gene ID: 8543
• mRNA Refseq: NM_006769
• Protein Refseq: NP_006760
• MIM: 603129
• UniProt ID: P61968