"LRG1" Related Products

Expand
Expand

Recombinant Human LRG1 protein, T7/His-tagged

Cat.No.: LRG1-54H
Product Overview: Recombinant human LRG1 cDNA (36 – 347 aa, derived from BC034389) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLT HLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLE VSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDL LLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQN LSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro LRG1 protein mediated cell adhesion pathway regulation study for various cancer cell growth controlling with this protein as either coating matrix protein or soluble factor.2. May be used as LRG1 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. Potential biomarker protein for various cancer diseases.5. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: LRG1 leucine-rich alpha-2-glycoprotein 1 [ Homo sapiens ]
Official Symbol: LRG1
Synonyms: LRG1; leucine-rich alpha-2-glycoprotein 1; leucine-rich alpha-2-glycoprotein; leucine rich alpha 2 glycoprotein; LRG; 1300008B03Rik; 2310031E04Rik; HMFT1766; FLJ45787;
Gene ID: 116844
mRNA Refseq: NM_052972
Protein Refseq: NP_443204
MIM: 611289
UniProt ID: P02750
Chromosome Location: 19
Function: molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.