Recombinant Human LRP4 protein(1781-1870 aa), C-His-tagged
| Cat.No. : | LRP4-2484H |
| Product Overview : | Recombinant Human LRP4 protein(O75096)(1781-1870 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1781-1870 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | IPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQ |
| ◆ Recombinant Proteins | ||
| LRP4-3728H | Recombinant Human LRP4 Protein (Arg1610-Arg1885), N-GST tagged | +Inquiry |
| LRP4-3383H | Recombinant Human LRP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRP4-5164M | Recombinant Mouse LRP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRP4-8206H | Recombinant Human LRP4 protein, His & GST-tagged | +Inquiry |
| LRP4-9237M | Recombinant Mouse LRP4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRP4 Products
Required fields are marked with *
My Review for All LRP4 Products
Required fields are marked with *
