Recombinant Human LRRC17 Protein, GST-tagged
Cat.No. : | LRRC17-4683H |
Product Overview : | Human LRRC17 full-length ORF ( AAH27903, 19 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LRRC17 (Leucine Rich Repeat Containing 17) is a Protein Coding gene. Diseases associated with LRRC17 include Neuroblastoma. An important paralog of this gene is LRRC3. |
Molecular Mass : | 72.27 kDa |
AA Sequence : | RKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVIITIVG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRC17 leucine rich repeat containing 17 [ Homo sapiens ] |
Official Symbol | LRRC17 |
Synonyms | LRRC17; leucine rich repeat containing 17; leucine-rich repeat-containing protein 17; H_RG318M05.3; P37NB; 37 kDa leucine-rich repeat (LRR) protein; |
Gene ID | 10234 |
mRNA Refseq | NM_001031692 |
Protein Refseq | NP_001026862 |
UniProt ID | Q8N6Y2 |
◆ Recombinant Proteins | ||
LRRC17-6030HF | Recombinant Full Length Human LRRC17 Protein, GST-tagged | +Inquiry |
LRRC17-11587Z | Recombinant Zebrafish LRRC17 | +Inquiry |
LRRC17-83H | Recombinant Human LRRC17, GST-tagged | +Inquiry |
LRRC17-8223H | Recombinant Human LRRC17 protein, His-KSI-tagged | +Inquiry |
LRRC17-4683H | Recombinant Human LRRC17 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC17-4648HCL | Recombinant Human LRRC17 293 Cell Lysate | +Inquiry |
LRRC17-4647HCL | Recombinant Human LRRC17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRC17 Products
Required fields are marked with *
My Review for All LRRC17 Products
Required fields are marked with *
0
Inquiry Basket