Recombinant Human LRRC20 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LRRC20-2147H
• Product Overview: LRRC20 MS Standard C13 and N15-labeled recombinant protein (NP_997002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LRRC20 (Leucine Rich Repeat Containing 20) is a Protein Coding gene.
• Molecular Mass: 20.5 kDa
• AA Sequence: MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LRRC20 leucine rich repeat containing 20 [ Homo sapiens (human) ]
• Official Symbol: LRRC20
• Synonyms: LRRC20; leucine rich repeat containing 20; leucine-rich repeat-containing protein 20; FLJ10751; FLJ10844
• Gene ID: 55222
• mRNA Refseq: NM_207119
• Protein Refseq: NP_997002
• UniProt ID: Q8TCA0