Recombinant Human LRRC3 Protein, His tagged

Cat.No. : LRRC3-001H
Product Overview : Recombinant Human LRRC3 Protein with His tag was expressed in HEK293.
Availability January 25, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 33-204 aa
Description : Predicted to be located in membrane. Predicted to be active in plasma membrane.
Molecular Mass : 20 kDa
Purity : > 90% by SDS-PAGE
AA Sequence : CPQPCRCPDHAGAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPHRTTDHHHHHHHH
Advantages : 1. Sensitive and accurate: The linearity can be kept between 0.5859 μM to 150 μM by using 10 μL sample per test. The "mix-and-read" procedure involves addition of a single working reagent and reading the optical density. Can be readily automated as a high-throughput assay in auto-analyser for thousands of samples per day. 2. Safety: Reagents are non-toxic. 3. Versatility: Assays can be executed in auto-analyser
Endotoxin : < 1.0 EU/μg by LAL
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL by BCA
Gene Name LRRC3 leucine rich repeat containing 3 [ Homo sapiens (human) ]
Official Symbol LRRC3
Synonyms LRRC3; leucine rich repeat containing 3; leucine-rich repeat-containing protein 3; LRRC3 downstream neighbor (non-protein coding); intronless long ORF, AL117578
Gene ID 81543
mRNA Refseq NM_030891
Protein Refseq NP_112153
MIM 617620
UniProt ID Q9BY71

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC3 Products

Required fields are marked with *

My Review for All LRRC3 Products

Required fields are marked with *

0
cart-icon
0
compare icon