Recombinant Human LRRC3 Protein, His tagged
| Cat.No. : | LRRC3-001H |
| Product Overview : | Recombinant Human LRRC3 Protein with His tag was expressed in HEK293. |
| Availability | December 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 33-204 aa |
| Description : | Predicted to be located in membrane. Predicted to be active in plasma membrane. |
| Molecular Mass : | 20 kDa |
| Purity : | > 90% by SDS-PAGE |
| AA Sequence : | CPQPCRCPDHAGAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPHRTTDHHHHHHHH |
| Advantages : | 1. Sensitive and accurate: The linearity can be kept between 0.5859 μM to 150 μM by using 10 μL sample per test. The "mix-and-read" procedure involves addition of a single working reagent and reading the optical density. Can be readily automated as a high-throughput assay in auto-analyser for thousands of samples per day. 2. Safety: Reagents are non-toxic. 3. Versatility: Assays can be executed in auto-analyser |
| Endotoxin : | < 1.0 EU/μg by LAL |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | LRRC3 leucine rich repeat containing 3 [ Homo sapiens (human) ] |
| Official Symbol | LRRC3 |
| Synonyms | LRRC3; leucine rich repeat containing 3; leucine-rich repeat-containing protein 3; LRRC3 downstream neighbor (non-protein coding); intronless long ORF, AL117578 |
| Gene ID | 81543 |
| mRNA Refseq | NM_030891 |
| Protein Refseq | NP_112153 |
| MIM | 617620 |
| UniProt ID | Q9BY71 |
| ◆ Recombinant Proteins | ||
| LRRC3-2378R | Recombinant Rhesus Macaque LRRC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRRC3-3118R | Recombinant Rat LRRC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRRC3-3462R | Recombinant Rat LRRC3 Protein | +Inquiry |
| LRRC3-001H | Recombinant Human LRRC3 Protein, His tagged | +Inquiry |
| RFL35609DF | Recombinant Full Length Danio Rerio Leucine-Rich Repeat-Containing Protein 3(Lrrc3) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRRC3-4637HCL | Recombinant Human LRRC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC3 Products
Required fields are marked with *
My Review for All LRRC3 Products
Required fields are marked with *
