Recombinant Human LRRC32 protein, His-tagged
| Cat.No. : | LRRC32-3748H |
| Product Overview : | Recombinant Human LRRC32 protein(477-662 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 477-662 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | PGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQYKA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LRRC32 leucine rich repeat containing 32 [ Homo sapiens ] |
| Official Symbol | LRRC32 |
| Synonyms | LRRC32; leucine rich repeat containing 32; D11S833E, GARP, glycoprotein A repetitions predominant; leucine-rich repeat-containing protein 32; garpin; glycoprotein A repetitions predominant; GARP; D11S833E; |
| Gene ID | 2615 |
| mRNA Refseq | NM_001128922 |
| Protein Refseq | NP_001122394 |
| MIM | 137207 |
| UniProt ID | Q14392 |
| ◆ Recombinant Proteins | ||
| Lrrc32-1520M | Recombinant Mouse Lrrc32 protein, His & T7-tagged | +Inquiry |
| LRRC32-0373H | Active Recombinant Human LRRC32 protein, Fc-tagged | +Inquiry |
| LRRC32-397H | Recombinant Human LRRC32, Fc-tagged | +Inquiry |
| Lrrc32-262M | Recombinant Mouse Lrrc32 and Latent TGF beta 1 Complex Protein, Ala18-Leu628 and Leu30-Ser390, N-His-Avi tagged, Biotinylated | +Inquiry |
| LRRC32-396H | Recombinant Human LRRC32 protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRRC32-4635HCL | Recombinant Human LRRC32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC32 Products
Required fields are marked with *
My Review for All LRRC32 Products
Required fields are marked with *
