Recombinant Human LRRC4 protein, His-tagged

• Cat.No.: LRRC4-180H
• Product Overview: Recombinant Human LRRC4 protein(Ala39-Lys527), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Ala39-Lys527
• Tag: C-His
• Form: Liquid in sterile PBS, pH7.4.
• Molecular Mass: The protein has a calculated MW of 56 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: ASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKAHHHHHHHH

Gene Information

• Gene Name: LRRC4 leucine rich repeat containing 4 [ Homo sapiens ]
• Official Symbol: LRRC4
• Synonyms: LRRC4; leucine rich repeat containing 4; leucine-rich repeat-containing protein 4; NAG14; netrin-G2 ligand; leucine-rich repeat-containing 4; brain tumor-associated protein BAG; brain tumor associated protein LRRC4; nasopharyngeal carcinoma-associated gene 14 protein; NGL-2; MGC133342; MGC133343
• Gene ID: 64101
• mRNA Refseq: NM_022143
• Protein Refseq: NP_071426
• MIM: 610486
• UniProt ID: Q9HBW1