Recombinant Human LRRC4 protein, His-tagged

Cat.No. : LRRC4-180H
Product Overview : Recombinant Human LRRC4 protein(Ala39-Lys527), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Ala39-Lys527
Tag : C-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 56 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : ASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKAHHHHHHHH
Gene Name LRRC4 leucine rich repeat containing 4 [ Homo sapiens ]
Official Symbol LRRC4
Synonyms LRRC4; leucine rich repeat containing 4; leucine-rich repeat-containing protein 4; NAG14; netrin-G2 ligand; leucine-rich repeat-containing 4; brain tumor-associated protein BAG; brain tumor associated protein LRRC4; nasopharyngeal carcinoma-associated gene 14 protein; NGL-2; MGC133342; MGC133343;
Gene ID 64101
mRNA Refseq NM_022143
Protein Refseq NP_071426
MIM 610486
UniProt ID Q9HBW1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC4 Products

Required fields are marked with *

My Review for All LRRC4 Products

Required fields are marked with *

0
cart-icon