Recombinant Human LRRC55 Protein, GST-tagged
| Cat.No. : | LRRC55-4652H |
| Product Overview : | Human LRRC55 full-length ORF ( NP_001005210.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | LRRC55 (Leucine Rich Repeat Containing 55) is a Protein Coding gene. An important paralog of this gene is LRRC38. |
| Molecular Mass : | 64 kDa |
| AA Sequence : | MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LRRC55 leucine rich repeat containing 55 [ Homo sapiens ] |
| Official Symbol | LRRC55 |
| Synonyms | LRRC55; leucine rich repeat containing 55 |
| Gene ID | 219527 |
| mRNA Refseq | NM_001005210 |
| Protein Refseq | NP_001005210 |
| UniProt ID | Q6ZSA7 |
| ◆ Recombinant Proteins | ||
| LRRC55-4652H | Recombinant Human LRRC55 Protein, GST-tagged | +Inquiry |
| LRRC55-973H | Recombinant Human LRRC55 Protein, MYC/DDK-tagged | +Inquiry |
| RFL8996HF | Recombinant Full Length Human Leucine-Rich Repeat-Containing Protein 55(Lrrc55) Protein, His-Tagged | +Inquiry |
| LRRC55-5195M | Recombinant Mouse LRRC55 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Lrrc55-3837M | Recombinant Mouse Lrrc55 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC55 Products
Required fields are marked with *
My Review for All LRRC55 Products
Required fields are marked with *



