Recombinant Human LRRFIP2 protein, GST-tagged
Cat.No. : | LRRFIP2-1836H |
Product Overview : | Recombinant Human LRRFIP2 protein(151-300 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 151-300 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | IEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LRRFIP2 leucine rich repeat (in FLII) interacting protein 2 [ Homo sapiens ] |
Official Symbol | LRRFIP2 |
Synonyms | LRRFIP2; leucine rich repeat (in FLII) interacting protein 2; leucine-rich repeat flightless-interacting protein 2; HUFI 2; LRR FLII-interacting protein 2; HUFI-2; FLJ20248; FLJ22683; FLJ58304; DKFZp434H2035; |
Gene ID | 9209 |
mRNA Refseq | NM_001134369 |
Protein Refseq | NP_001127841 |
MIM | 614043 |
UniProt ID | Q9Y608 |
◆ Recombinant Proteins | ||
LRRFIP2-4641H | Recombinant Human LRRFIP2 Protein, GST-tagged | +Inquiry |
LRRFIP2-969H | Recombinant Human LRRFIP2 Protein, MYC/DDK-tagged | +Inquiry |
LRRFIP2-1836H | Recombinant Human LRRFIP2 protein, GST-tagged | +Inquiry |
LRRFIP2-3140R | Recombinant Rat LRRFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lrrfip2-3845M | Recombinant Mouse Lrrfip2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRFIP2-1034HCL | Recombinant Human LRRFIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRFIP2 Products
Required fields are marked with *
My Review for All LRRFIP2 Products
Required fields are marked with *
0
Inquiry Basket