Recombinant Human LRRFIP2 protein, GST-tagged
| Cat.No. : | LRRFIP2-1836H |
| Product Overview : | Recombinant Human LRRFIP2 protein(151-300 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 151-300 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | IEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | LRRFIP2 leucine rich repeat (in FLII) interacting protein 2 [ Homo sapiens ] |
| Official Symbol | LRRFIP2 |
| Synonyms | LRRFIP2; leucine rich repeat (in FLII) interacting protein 2; leucine-rich repeat flightless-interacting protein 2; HUFI 2; LRR FLII-interacting protein 2; HUFI-2; FLJ20248; FLJ22683; FLJ58304; DKFZp434H2035; |
| Gene ID | 9209 |
| mRNA Refseq | NM_001134369 |
| Protein Refseq | NP_001127841 |
| MIM | 614043 |
| UniProt ID | Q9Y608 |
| ◆ Recombinant Proteins | ||
| LRRFIP2-495H | Recombinant Human LRRFIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LRRFIP2-9920Z | Recombinant Zebrafish LRRFIP2 | +Inquiry |
| LRRFIP2-3449Z | Recombinant Zebrafish LRRFIP2 | +Inquiry |
| LRRFIP2-3484R | Recombinant Rat LRRFIP2 Protein | +Inquiry |
| LRRFIP2-1836H | Recombinant Human LRRFIP2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRRFIP2-1034HCL | Recombinant Human LRRFIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRFIP2 Products
Required fields are marked with *
My Review for All LRRFIP2 Products
Required fields are marked with *
