Recombinant Human LRRN4CL Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LRRN4CL-5764H
• Product Overview: LRRN4CL MS Standard C13 and N15-labeled recombinant protein (NP_981967) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LRRN4CL (LRRN4 C-Terminal Like) is a Protein Coding gene. An important paralog of this gene is LRRN4.
• Molecular Mass: 25.1 kDa
• AA Sequence: MLGSPCLLWLLAVTFLVPRAQPLAPQDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAANEAGASRVPQAGGEGLEGADIPAFGPCSRLAVPPNPRTLVHAAVGVGTALALLSCAALVWHFCLRDRWGCPRRAAARAAGALTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LRRN4CL LRRN4 C-terminal like [ Homo sapiens (human) ]
• Official Symbol: LRRN4CL
• Synonyms: LRRN4CL; LRRN4 C-terminal like; LRRN4 C-terminal-like protein
• Gene ID: 221091
• mRNA Refseq: NM_203422
• Protein Refseq: NP_981967
• UniProt ID: Q8ND94