Recombinant Human LSAMP Protein, GST-tagged
| Cat.No. : | LSAMP-4620H |
| Product Overview : | Human LSAMP full-length ORF (AAH33803, 29 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections. [provided by RefSeq |
| Molecular Mass : | 59.62 kDa |
| AA Sequence : | VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LSAMP limbic system-associated membrane protein [ Homo sapiens ] |
| Official Symbol | LSAMP |
| Synonyms | LSAMP; limbic system-associated membrane protein; IgLON family member 3; IGLON3; LAMP; FLJ34254; FLJ35396; FLJ37216; FLJ54658; |
| Gene ID | 4045 |
| mRNA Refseq | NM_002338 |
| Protein Refseq | NP_002329 |
| MIM | 603241 |
| UniProt ID | Q13449 |
| ◆ Recombinant Proteins | ||
| LSAMP-6117HF | Recombinant Full Length Human LSAMP Protein, GST-tagged | +Inquiry |
| LSAMP-6983H | Recombinant Human LSAMP protein, His-tagged | +Inquiry |
| LSAMP-3671Z | Recombinant Zebrafish LSAMP | +Inquiry |
| LSAMP-6437C | Recombinant Chicken LSAMP | +Inquiry |
| LSAMP-3149R | Recombinant Rat LSAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSAMP-1755HCL | Recombinant Human LSAMP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSAMP Products
Required fields are marked with *
My Review for All LSAMP Products
Required fields are marked with *
