Recombinant Human LSAMP protein, T7/His-tagged

Cat.No. : LSAMP-152H
Product Overview : Recombinant human mature LSAMP cDNA (29 -315aa, derived from BC033803) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGH DKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVT LVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESK SNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTN ASLVLFRPGSVRGIN
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro LSAMP mediated neuronal connection regulation study for neurogenesis with this protein as either coating matrix protein or soluble factor.2. May be used for LSAMP protein-protein interaction assay.3. Potential diagnostic biomarker protein for various tumor and neuronal diseases.4. As antigen for specific antibody production.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name LSAMP limbic system-associated membrane protein [ Homo sapiens ]
Official Symbol LSAMP
Synonyms LSAMP; limbic system-associated membrane protein; IgLON family member 3; IGLON3; LAMP; FLJ34254; FLJ35396; FLJ37216; FLJ54658;
Gene ID 4045
mRNA Refseq NM_002338
Protein Refseq NP_002329
MIM 603241
UniProt ID Q13449
Chromosome Location 3q13.2-q21
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSAMP Products

Required fields are marked with *

My Review for All LSAMP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon