Recombinant Human LSAMP protein, T7/His-tagged
Cat.No. : | LSAMP-152H |
Product Overview : | Recombinant human mature LSAMP cDNA (29 -315aa, derived from BC033803) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGH DKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVT LVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESK SNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTN ASLVLFRPGSVRGIN |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro LSAMP mediated neuronal connection regulation study for neurogenesis with this protein as either coating matrix protein or soluble factor.2. May be used for LSAMP protein-protein interaction assay.3. Potential diagnostic biomarker protein for various tumor and neuronal diseases.4. As antigen for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | LSAMP limbic system-associated membrane protein [ Homo sapiens ] |
Official Symbol | LSAMP |
Synonyms | LSAMP; limbic system-associated membrane protein; IgLON family member 3; IGLON3; LAMP; FLJ34254; FLJ35396; FLJ37216; FLJ54658; |
Gene ID | 4045 |
mRNA Refseq | NM_002338 |
Protein Refseq | NP_002329 |
MIM | 603241 |
UniProt ID | Q13449 |
Chromosome Location | 3q13.2-q21 |
Function | protein binding; |
◆ Recombinant Proteins | ||
LSAMP-3493R | Recombinant Rat LSAMP Protein | +Inquiry |
LSAMP-3992H | Recombinant Human LSAMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LSAMP-4620H | Recombinant Human LSAMP Protein, GST-tagged | +Inquiry |
LSAMP-6983H | Recombinant Human LSAMP protein, His-tagged | +Inquiry |
LSAMP-972H | Recombinant Human LSAMP Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSAMP-1755HCL | Recombinant Human LSAMP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSAMP Products
Required fields are marked with *
My Review for All LSAMP Products
Required fields are marked with *