Recombinant Human LSM3 Protein, GST-tagged
| Cat.No. : | LSM3-4609H |
| Product Overview : | Human LSM3 full-length ORF ( AAH07055, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM |
| Molecular Mass : | 36.96 kDa |
| AA Sequence : | MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | LSM3 |
| Synonyms | LSM3; LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm3; SMX4; USS2; YLR438C; |
| Gene ID | 27258 |
| mRNA Refseq | NM_014463 |
| Protein Refseq | NP_055278 |
| MIM | 607283 |
| UniProt ID | P62310 |
| ◆ Recombinant Proteins | ||
| LSM3--8659H | Recombinant Human LSM3, His tagged | +Inquiry |
| LSM3-2583R | Recombinant Rhesus monkey LSM3 Protein, His-tagged | +Inquiry |
| LSM3-808H | Recombinant Human LSM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LSM3-9332M | Recombinant Mouse LSM3 Protein | +Inquiry |
| LSM3-5209C | Recombinant Chicken LSM3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSM3-9174HCL | Recombinant Human LSM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM3 Products
Required fields are marked with *
My Review for All LSM3 Products
Required fields are marked with *
