Recombinant Human LSM3 Protein, GST-tagged
Cat.No. : | LSM3-4609H |
Product Overview : | Human LSM3 full-length ORF ( AAH07055, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM |
Molecular Mass : | 36.96 kDa |
AA Sequence : | MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | LSM3 |
Synonyms | LSM3; LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm3; SMX4; USS2; YLR438C; |
Gene ID | 27258 |
mRNA Refseq | NM_014463 |
Protein Refseq | NP_055278 |
MIM | 607283 |
UniProt ID | P62310 |
◆ Recombinant Proteins | ||
LSM3-2403R | Recombinant Rhesus Macaque LSM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LSM3-5995HF | Recombinant Full Length Human LSM3 Protein, GST-tagged | +Inquiry |
LSM3-2583R | Recombinant Rhesus monkey LSM3 Protein, His-tagged | +Inquiry |
LSM3-653H | Recombinant Human LSM3, His-tagged | +Inquiry |
LSM3-5226M | Recombinant Mouse LSM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM3-9174HCL | Recombinant Human LSM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM3 Products
Required fields are marked with *
My Review for All LSM3 Products
Required fields are marked with *