Recombinant Human LSM4 protein, His-SUMO-tagged
Cat.No. : | LSM4-3185H |
Product Overview : | Recombinant Human LSM4 protein(Q9Y4Z0)(1-139aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-139aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.3 kDa |
AA Sequence : | MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | LSM4 |
Synonyms | LSM4; LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm4; YER112W; glycine-rich protein; GRP; |
Gene ID | 25804 |
mRNA Refseq | NM_001252129 |
Protein Refseq | NP_001239058 |
MIM | 607284 |
UniProt ID | Q9Y4Z0 |
◆ Recombinant Proteins | ||
LSM4-4608H | Recombinant Human LSM4 Protein, GST-tagged | +Inquiry |
LSM4-188H | Recombinant Human LSM4 Protein, His-tagged | +Inquiry |
LSM4-3007H | Recombinant Human LSM4 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae), T7-tagged | +Inquiry |
LSM4-1867H | Recombinant Human LSM4 protein, GST-tagged | +Inquiry |
LSM4-2404R | Recombinant Rhesus Macaque LSM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM4-9173HCL | Recombinant Human LSM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LSM4 Products
Required fields are marked with *
My Review for All LSM4 Products
Required fields are marked with *
0
Inquiry Basket