Recombinant Human LSM4 protein, His-SUMO-tagged
| Cat.No. : | LSM4-3185H |
| Product Overview : | Recombinant Human LSM4 protein(Q9Y4Z0)(1-139aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-139aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.3 kDa |
| AA Sequence : | MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | LSM4 |
| Synonyms | LSM4; LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm4; YER112W; glycine-rich protein; GRP; |
| Gene ID | 25804 |
| mRNA Refseq | NM_001252129 |
| Protein Refseq | NP_001239058 |
| MIM | 607284 |
| UniProt ID | Q9Y4Z0 |
| ◆ Recombinant Proteins | ||
| LSM4-3398H | Recombinant Human LSM4, His-tagged | +Inquiry |
| LSM4-4608H | Recombinant Human LSM4 Protein, GST-tagged | +Inquiry |
| LSM4-188H | Recombinant Human LSM4 Protein, His-tagged | +Inquiry |
| LSM4-2584R | Recombinant Rhesus monkey LSM4 Protein, His-tagged | +Inquiry |
| LSM4-10962Z | Recombinant Zebrafish LSM4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSM4-9173HCL | Recombinant Human LSM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM4 Products
Required fields are marked with *
My Review for All LSM4 Products
Required fields are marked with *
