Recombinant Human LSM4 protein, His-SUMO-tagged

Cat.No. : LSM4-3185H
Product Overview : Recombinant Human LSM4 protein(Q9Y4Z0)(1-139aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-139aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.3 kDa
AA Sequence : MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ]
Official Symbol LSM4
Synonyms LSM4; LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm4; YER112W; glycine-rich protein; GRP;
Gene ID 25804
mRNA Refseq NM_001252129
Protein Refseq NP_001239058
MIM 607284
UniProt ID Q9Y4Z0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSM4 Products

Required fields are marked with *

My Review for All LSM4 Products

Required fields are marked with *

0
cart-icon