Recombinant Human LSM7 protein, His-tagged
| Cat.No. : | LSM7-7876H |
| Product Overview : | Recombinant Human LSM7 protein(1-103 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-103 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | LSM7 |
| Synonyms | LSM7; LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm7; YNL147W; |
| mRNA Refseq | NM_016199 |
| Protein Refseq | NP_057283 |
| MIM | 607287 |
| UniProt ID | Q9UK45 |
| Gene ID | 51690 |
| ◆ Recombinant Proteins | ||
| LSM7-9336M | Recombinant Mouse LSM7 Protein | +Inquiry |
| LSM7-4443Z | Recombinant Zebrafish LSM7 | +Inquiry |
| LSM7-7876H | Recombinant Human LSM7 protein, His-tagged | +Inquiry |
| LSM7-5229M | Recombinant Mouse LSM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LSM7-7875H | Recombinant Human LSM7 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSM7-9170HCL | Recombinant Human LSM7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM7 Products
Required fields are marked with *
My Review for All LSM7 Products
Required fields are marked with *
