"LTA4H" Related Products

Expand
Expand
Expand

Recombinant Human LTA4H protein, T7/His-tagged

Cat.No.: LTA4H-84H
Product Overview: Recombinant human LTA4H cDNA ( 610 aa, derived from BC032528 ) fused with T7-His-TEV cleavage site Tag (31aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.20 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGSPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQS QEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQK VPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGG MENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALG GWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNATDLKDL SSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRP LFKDLAAFDKSHDQAVRTYQEHKASMHPVTAMLVGKDLKVD
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro LTA4H protein mediated inflammation / insulin resistance regulation in macrophage / liver cells study by intracellular delivery of this protein with "ProFectin" reagent.2. May be used for mapping LTA4H protein-protein interaction.3. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: LTA4H leukotriene A4 hydrolase [ Homo sapiens ]
Official Symbol: LTA4H
Synonyms: LTA4H; leukotriene A4 hydrolase; leukotriene A-4 hydrolase; LTA-4 hydrolase; FLJ17564;
Gene ID: 4048
mRNA Refseq: NM_000895
Protein Refseq: NP_000886
MIM: 151570
UniProt ID: P09960
Chromosome Location: 12q22
Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Leukotriene synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem
Function: aminopeptidase activity; binding; epoxide hydrolase activity; epoxide hydrolase activity; leukotriene-A4 hydrolase activity; leukotriene-A4 hydrolase activity; metal ion binding; metallopeptidase activity; peptidase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.