Recombinant Human LTK Protein, GST-tagged

• Cat.No.: LTK-4585H
• Product Overview: Human LTK partial ORF ( NP_002335, 355 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the ros/insulin receptor family of tyrosine kinases. Tyrosine-specific phosphorylation of proteins is a key to the control of diverse pathways leading to cell growth and differentiation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 37.29 kDa
• AA Sequence: PSSELFLQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHKPPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LTK leukocyte receptor tyrosine kinase [ Homo sapiens ]
• Official Symbol: LTK
• Synonyms: LTK; leukocyte receptor tyrosine kinase; leukocyte tyrosine kinase; leukocyte tyrosine kinase receptor; TYK1; protein tyrosine kinase 1
• Gene ID: 4058
• mRNA Refseq: NM_001135685
• Protein Refseq: NP_001129157
• MIM: 151520
• UniProt ID: P29376