Recombinant Human LTK Protein, GST-tagged

Cat.No. : LTK-4585H
Product Overview : Human LTK partial ORF ( NP_002335, 355 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the ros/insulin receptor family of tyrosine kinases. Tyrosine-specific phosphorylation of proteins is a key to the control of diverse pathways leading to cell growth and differentiation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 37.29 kDa
AA Sequence : PSSELFLQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHKPPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LTK leukocyte receptor tyrosine kinase [ Homo sapiens ]
Official Symbol LTK
Synonyms LTK; leukocyte receptor tyrosine kinase; leukocyte tyrosine kinase; leukocyte tyrosine kinase receptor; TYK1; protein tyrosine kinase 1;
Gene ID 4058
mRNA Refseq NM_001135685
Protein Refseq NP_001129157
MIM 151520
UniProt ID P29376

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LTK Products

Required fields are marked with *

My Review for All LTK Products

Required fields are marked with *

0
cart-icon
0
compare icon