Recombinant Human LTK Protein, GST-tagged
Cat.No. : | LTK-4585H |
Product Overview : | Human LTK partial ORF ( NP_002335, 355 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the ros/insulin receptor family of tyrosine kinases. Tyrosine-specific phosphorylation of proteins is a key to the control of diverse pathways leading to cell growth and differentiation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 37.29 kDa |
AA Sequence : | PSSELFLQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHKPPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LTK leukocyte receptor tyrosine kinase [ Homo sapiens ] |
Official Symbol | LTK |
Synonyms | LTK; leukocyte receptor tyrosine kinase; leukocyte tyrosine kinase; leukocyte tyrosine kinase receptor; TYK1; protein tyrosine kinase 1; |
Gene ID | 4058 |
mRNA Refseq | NM_001135685 |
Protein Refseq | NP_001129157 |
MIM | 151520 |
UniProt ID | P29376 |
◆ Recombinant Proteins | ||
LTK-0998H | Recombinant Human LTK Protein (K450-S864), Tag Free | +Inquiry |
LTK-1613Z | Recombinant Zebrafish LTK | +Inquiry |
LTK-1448H | Recombinant Human LTK protein, His-tagged | +Inquiry |
Ltk-1400M | Recombinant Mouse Ltk protein, His-tagged | +Inquiry |
LTK-3403H | Recombinant Human LTK Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTK Products
Required fields are marked with *
My Review for All LTK Products
Required fields are marked with *
0
Inquiry Basket