Recombinant Human LUC7L3 Protein (1-79 aa), His-tagged

• Cat.No.: LUC7L3-998H
• Product Overview: Recombinant Human LUC7L3 Protein (1-79 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-79 aa
• Description: Binds cAMP regulatory elent DNA sequence. May play a role in RNA splicing.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 13.3 kDa
• AA Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: LUC7L3 LUC7-like 3 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: LUC7L3
• Synonyms: LUC7L3; CRA; CREAP 1; CROP; FLJ11063; hLuc7A; LUC7A; OA48 18; CREAP-1; OA48-18
• Gene ID: 51747
• mRNA Refseq: NM_006107
• Protein Refseq: NP_006098
• MIM: 609434
• UniProt ID: O95232