Recombinant Human LUC7L3 Protein (1-79 aa), His-tagged

Cat.No. : LUC7L3-998H
Product Overview : Recombinant Human LUC7L3 Protein (1-79 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-79 aa
Description : Binds cAMP regulatory elent DNA sequence. May play a role in RNA splicing.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 13.3 kDa
AA Sequence : MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name LUC7L3 LUC7-like 3 (S. cerevisiae) [ Homo sapiens ]
Official Symbol LUC7L3
Synonyms LUC7L3; CRA; CREAP 1; CROP; FLJ11063; hLuc7A; LUC7A; OA48 18; CREAP-1; OA48-18;
Gene ID 51747
mRNA Refseq NM_006107
Protein Refseq NP_006098
MIM 609434
UniProt ID O95232

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LUC7L3 Products

Required fields are marked with *

My Review for All LUC7L3 Products

Required fields are marked with *

0
cart-icon
0
compare icon