Recombinant Human LUC7L3 Protein (1-79 aa), His-tagged
| Cat.No. : | LUC7L3-998H |
| Product Overview : | Recombinant Human LUC7L3 Protein (1-79 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-79 aa |
| Description : | Binds cAMP regulatory elent DNA sequence. May play a role in RNA splicing. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 13.3 kDa |
| AA Sequence : | MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | LUC7L3 LUC7-like 3 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | LUC7L3 |
| Synonyms | LUC7L3; CRA; CREAP 1; CROP; FLJ11063; hLuc7A; LUC7A; OA48 18; CREAP-1; OA48-18; |
| Gene ID | 51747 |
| mRNA Refseq | NM_006107 |
| Protein Refseq | NP_006098 |
| MIM | 609434 |
| UniProt ID | O95232 |
| ◆ Recombinant Proteins | ||
| LUC7L3-5243M | Recombinant Mouse LUC7L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LUC7L3-9359M | Recombinant Mouse LUC7L3 Protein | +Inquiry |
| LUC7L3-2592R | Recombinant Rhesus monkey LUC7L3 Protein, His-tagged | +Inquiry |
| LUC7L3-2412R | Recombinant Rhesus Macaque LUC7L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LUC7L3-636H | Recombinant Human LUC7L3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LUC7L3 Products
Required fields are marked with *
My Review for All LUC7L3 Products
Required fields are marked with *



