Recombinant Human LUC7L3 Protein (1-79 aa), His-tagged
Cat.No. : | LUC7L3-998H |
Product Overview : | Recombinant Human LUC7L3 Protein (1-79 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-79 aa |
Description : | Binds cAMP regulatory elent DNA sequence. May play a role in RNA splicing. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 13.3 kDa |
AA Sequence : | MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | LUC7L3 LUC7-like 3 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | LUC7L3 |
Synonyms | LUC7L3; CRA; CREAP 1; CROP; FLJ11063; hLuc7A; LUC7A; OA48 18; CREAP-1; OA48-18; |
Gene ID | 51747 |
mRNA Refseq | NM_006107 |
Protein Refseq | NP_006098 |
MIM | 609434 |
UniProt ID | O95232 |
◆ Recombinant Proteins | ||
LUC7L3-3174C | Recombinant Chicken LUC7L3 | +Inquiry |
LUC7L3-5243M | Recombinant Mouse LUC7L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LUC7L3-1900H | Recombinant Human LUC7L3 Protein, GST-tagged | +Inquiry |
LUC7L3-9359M | Recombinant Mouse LUC7L3 Protein | +Inquiry |
LUC7L3-2091HF | Recombinant Full Length Human LUC7L3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LUC7L3 Products
Required fields are marked with *
My Review for All LUC7L3 Products
Required fields are marked with *
0
Inquiry Basket