Recombinant Human LY6G6D protein, His-B2M-JD-tagged
Cat.No. : | LY6G6D-3190H |
Product Overview : | Recombinant Human LY6G6D protein(O95868)(10-104aa), fused to N-terminal His tag and B2M and JD tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His&JD |
Protein Length : | 10-104aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.5 kDa |
AA Sequence : | LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
Ly6g6d-4253R | Recombinant Rat Ly6g6d protein, His-tagged | +Inquiry |
LY6G6D-9182H | Recombinant Human LY6G6D Protein(10-104aa), His-tagged | +Inquiry |
LY6G6D-4633C | Recombinant Cynomolgus monkey LY6G6D protein, His-tagged | +Inquiry |
LY6G6D-1449H | Recombinant Human LY6G6D Protein (20-104 aa), His-tagged | +Inquiry |
LY6G6D-3189H | Recombinant Human LY6G6D protein, His-B2M-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6G6D-4599HCL | Recombinant Human LY6G6D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6G6D Products
Required fields are marked with *
My Review for All LY6G6D Products
Required fields are marked with *