Recombinant Human LYG1 protein, His-tagged
Cat.No. : | LYG1-3848H |
Product Overview : | Recombinant Human LYG1 protein(23-194 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-194 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LYG1 lysozyme G-like 1 [ Homo sapiens ] |
Official Symbol | LYG1 |
Synonyms | LYG1; lysozyme G-like 1; lysozyme g-like protein 1; SALW1939; |
Gene ID | 129530 |
mRNA Refseq | NM_174898 |
Protein Refseq | NP_777558 |
UniProt ID | Q8N1E2 |
◆ Recombinant Proteins | ||
LYG1-8587H | Recombinant Human LYG1, His & GST tagged | +Inquiry |
LYG1-4562H | Recombinant Human LYG1 Protein, GST-tagged | +Inquiry |
LYG1-2347H | Recombinant Human LYG1 protein, His-tagged | +Inquiry |
LYG1-2422R | Recombinant Rhesus Macaque LYG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYG1-2602R | Recombinant Rhesus monkey LYG1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYG1-001HCL | Recombinant Human LYG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYG1 Products
Required fields are marked with *
My Review for All LYG1 Products
Required fields are marked with *
0
Inquiry Basket