Recombinant Human LYG2 Protein, GST-tagged
| Cat.No. : | LYG2-4561H |
| Product Overview : | Human LYG2 full-length ORF ( NP_783862.2, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene contains a SLT domain, a protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL). SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc). [provided by RefSeq |
| Molecular Mass : | 49.9 kDa |
| AA Sequence : | MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LYG2 lysozyme G-like 2 [ Homo sapiens ] |
| Official Symbol | LYG2 |
| Synonyms | LYG2; lysozyme G-like 2; lysozyme g-like protein 2; LYGH; MGC119046; MGC119047; MGC119049; |
| Gene ID | 254773 |
| mRNA Refseq | NM_175735 |
| Protein Refseq | NP_783862 |
| UniProt ID | Q86SG7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYG2 Products
Required fields are marked with *
My Review for All LYG2 Products
Required fields are marked with *
Recently Viewed
