Recombinant Human LYG2 Protein, GST-tagged

• Cat.No.: LYG2-4561H
• Product Overview: Human LYG2 full-length ORF ( NP_783862.2, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene contains a SLT domain, a protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL). SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc). [provided by RefSeq
• Molecular Mass: 49.9 kDa
• AA Sequence: MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYG2 lysozyme G-like 2 [ Homo sapiens ]
• Official Symbol: LYG2
• Synonyms: LYG2; lysozyme G-like 2; lysozyme g-like protein 2; LYGH; MGC119046; MGC119047; MGC119049
• Gene ID: 254773
• mRNA Refseq: NM_175735
• Protein Refseq: NP_783862
• UniProt ID: Q86SG7