Recombinant Human LYPD1 Protein, His tagged

• Cat.No.: LYPD1-001H
• Product Overview: Recombinant Human LYPD1 Protein (54-116 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 54-116 aa
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.0, 10% Glycerol, 8% Trehalose
• AA Sequence: MCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSHHHHHHHH
• Endotoxin: <1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Concentration: 1 mg/mL by BCA

Gene Information

• Official Symbol: LYPD1
• Synonyms: LYPD1; LY6/PLAUR domain containing 1; LYPDC1; ly6/PLAUR domain-containing protein 1; MGC29643; putative HeLa tumor suppressor; PHTS; FLJ41033
• Gene ID: 116372
• mRNA Refseq: NM_001077427
• Protein Refseq: NP_001070895
• MIM: 610450
• UniProt ID: Q8N2G4