Recombinant Human LYPD1 Protein, His tagged
| Cat.No. : | LYPD1-001H |
| Product Overview : | Recombinant Human LYPD1 Protein (54-116 aa) with His tag was expressed in E. coli. |
| Availability | August 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 54-116 aa |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.0, 10% Glycerol, 8% Trehalose |
| AA Sequence : | MCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSHHHHHHHH |
| Endotoxin : | <1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Concentration : | 1 mg/mL by BCA |
| Official Symbol | LYPD1 |
| Synonyms | LYPD1; LY6/PLAUR domain containing 1; LYPDC1; ly6/PLAUR domain-containing protein 1; MGC29643; putative HeLa tumor suppressor; PHTS; FLJ41033; |
| Gene ID | 116372 |
| mRNA Refseq | NM_001077427 |
| Protein Refseq | NP_001070895 |
| MIM | 610450 |
| UniProt ID | Q8N2G4 |
| ◆ Recombinant Proteins | ||
| LYPD1-3515R | Recombinant Rat LYPD1 Protein | +Inquiry |
| LYPD1-0364H | Recombinant Human LYPD1 protein, mFc-tagged | +Inquiry |
| LYPD1-0366H | Recombinant Human LYPD1 protein, Fc-tagged | +Inquiry |
| LYPD1-248H | Active Recombinant Human LYPD1 protein, hFc-tagged | +Inquiry |
| LYPD1-3171R | Recombinant Rat LYPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYPD1-4592HCL | Recombinant Human LYPD1 293 Cell Lysate | +Inquiry |
| LYPD1-4593HCL | Recombinant Human LYPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPD1 Products
Required fields are marked with *
My Review for All LYPD1 Products
Required fields are marked with *



