Recombinant Human LYPD1 Protein, His tagged

Cat.No. : LYPD1-001H
Product Overview : Recombinant Human LYPD1 Protein (54-116 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 54-116 aa
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.0, 10% Glycerol, 8% Trehalose
AA Sequence : MCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSHHHHHHHH
Endotoxin : <1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Concentration : 1 mg/mL by BCA
Official Symbol LYPD1
Synonyms LYPD1; LY6/PLAUR domain containing 1; LYPDC1; ly6/PLAUR domain-containing protein 1; MGC29643; putative HeLa tumor suppressor; PHTS; FLJ41033;
Gene ID 116372
mRNA Refseq NM_001077427
Protein Refseq NP_001070895
MIM 610450
UniProt ID Q8N2G4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYPD1 Products

Required fields are marked with *

My Review for All LYPD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon