Recombinant Human LYPD1 Protein, His tagged
Cat.No. : | LYPD1-001H |
Product Overview : | Recombinant Human LYPD1 Protein (54-116 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 54-116 aa |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.0, 10% Glycerol, 8% Trehalose |
AA Sequence : | MCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSHHHHHHHH |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Concentration : | 1 mg/mL by BCA |
Official Symbol | LYPD1 |
Synonyms | LYPD1; LY6/PLAUR domain containing 1; LYPDC1; ly6/PLAUR domain-containing protein 1; MGC29643; putative HeLa tumor suppressor; PHTS; FLJ41033; |
Gene ID | 116372 |
mRNA Refseq | NM_001077427 |
Protein Refseq | NP_001070895 |
MIM | 610450 |
UniProt ID | Q8N2G4 |
◆ Recombinant Proteins | ||
LYPD1-132H | Recombinant Human LYPD1, His-tagged | +Inquiry |
LYPD1-9388M | Recombinant Mouse LYPD1 Protein | +Inquiry |
LYPD1-07H | Recombinant Human LYPD1 protein, GST/His-tagged | +Inquiry |
LYPD1-248H | Active Recombinant Human LYPD1 protein, hFc-tagged | +Inquiry |
LYPD1-9237H | Active Recombinant Human LYPD1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LYPD1-001H | Recombinant Human LYPD1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPD1-4592HCL | Recombinant Human LYPD1 293 Cell Lysate | +Inquiry |
LYPD1-4593HCL | Recombinant Human LYPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPD1 Products
Required fields are marked with *
My Review for All LYPD1 Products
Required fields are marked with *
0
Inquiry Basket