Recombinant Human LYPD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LYPD2-3045H |
| Product Overview : | LYPD2 MS Standard C13 and N15-labeled recombinant protein (NP_991108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Nucleotidyltransferase that act as a non-canonical poly(A) RNA polymerase which enhances mRNA stability and gene expression. Mainly targets mRNAs encoding endoplasmic reticulum-targeted protein and may be involved in induction of cell death. |
| Molecular Mass : | 13.1 kDa |
| AA Sequence : | MRGTQLVLLALVLAACGELAPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIVYPFQGDSTVTKSCASKCKPSDVDGIGQTLPVSCCNTELCNVDGAPALNSLHCGALTLLPLLSLRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LYPD2 LY6/PLAUR domain containing 2 [ Homo sapiens (human) ] |
| Official Symbol | LYPD2 |
| Synonyms | LYPD2; LY6/PLAUR domain containing 2; LYPDC2; UNQ430; ly6/PLAUR domain-containing protein 2; RGTR430 |
| Gene ID | 137797 |
| mRNA Refseq | NM_205545 |
| Protein Refseq | NP_991108 |
| UniProt ID | Q6UXB3 |
| ◆ Recombinant Proteins | ||
| LYPD2-9389M | Recombinant Mouse LYPD2 Protein | +Inquiry |
| Lypd2-3878M | Recombinant Mouse Lypd2 Protein, Myc/DDK-tagged | +Inquiry |
| LYPD2-994HFL | Recombinant Full Length Human LYPD2 Protein, C-Flag-tagged | +Inquiry |
| LYPD2-3701H | Recombinant Human LYPD2 protein, GST-tagged | +Inquiry |
| LYPD2-1333H | Recombinant Human LYPD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYPD2-4591HCL | Recombinant Human LYPD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPD2 Products
Required fields are marked with *
My Review for All LYPD2 Products
Required fields are marked with *




