Recombinant Full Length Human LYPD2 Protein, C-Flag-tagged
Cat.No. : | LYPD2-994HFL |
Product Overview : | Recombinant Full Length Human LYPD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be located in extracellular region and plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 12.9 kDa |
AA Sequence : | MRGTQLVLLALVLAACGELAPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIVYPFQGDSTVT KSCASKCKPSDVDGIGQTLPVSCCNTELCNVDGAPALNSLHCGALTLLPLLSLRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | LYPD2 LY6/PLAUR domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | LYPD2 |
Synonyms | LYPDC2; UNQ430 |
Gene ID | 137797 |
mRNA Refseq | NM_205545.3 |
Protein Refseq | NP_991108.1 |
UniProt ID | Q6UXB3 |
◆ Recombinant Proteins | ||
LYPD2-3701H | Recombinant Human LYPD2 protein, GST-tagged | +Inquiry |
LYPD2-1333H | Recombinant Human LYPD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPD2-9389M | Recombinant Mouse LYPD2 Protein | +Inquiry |
LYPD2-3045H | Recombinant Human LYPD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Lypd2-3878M | Recombinant Mouse Lypd2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPD2-4591HCL | Recombinant Human LYPD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPD2 Products
Required fields are marked with *
My Review for All LYPD2 Products
Required fields are marked with *