Recombinant Full Length Human LYPD2 Protein, C-Flag-tagged

• Cat.No.: LYPD2-994HFL
• Product Overview: Recombinant Full Length Human LYPD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to be located in extracellular region and plasma membrane.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 12.9 kDa
• AA Sequence: MRGTQLVLLALVLAACGELAPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIVYPFQGDSTVT
  KSCASKCKPSDVDGIGQTLPVSCCNTELCNVDGAPALNSLHCGALTLLPLLSLRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: LYPD2 LY6/PLAUR domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: LYPD2
• Synonyms: LYPDC2; UNQ430
• Gene ID: 137797
• mRNA Refseq: NM_205545.3
• Protein Refseq: NP_991108.1
• UniProt ID: Q6UXB3