Recombinant Human LYPLAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LYPLAL1-3989H
Product Overview : LYPLAL1 MS Standard C13 and N15-labeled recombinant protein (NP_620149) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LYPLAL1 (Lysophospholipase Like 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include hydrolase activity and lysophospholipase activity. An important paralog of this gene is LYPLA1.
Molecular Mass : 26.3 kDa
AA Sequence : MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LYPLAL1 lysophospholipase-like 1 [ Homo sapiens (human) ]
Official Symbol LYPLAL1
Synonyms LYPLAL1; lysophospholipase-like 1; lysophospholipase-like protein 1; Q96AV0; FLJ99730; KIAA1238;
Gene ID 127018
mRNA Refseq NM_138794
Protein Refseq NP_620149
MIM 616548
UniProt ID Q5VWZ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYPLAL1 Products

Required fields are marked with *

My Review for All LYPLAL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon