Recombinant Human LYPLAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LYPLAL1-3989H |
Product Overview : | LYPLAL1 MS Standard C13 and N15-labeled recombinant protein (NP_620149) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | LYPLAL1 (Lysophospholipase Like 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include hydrolase activity and lysophospholipase activity. An important paralog of this gene is LYPLA1. |
Molecular Mass : | 26.3 kDa |
AA Sequence : | MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LYPLAL1 lysophospholipase-like 1 [ Homo sapiens (human) ] |
Official Symbol | LYPLAL1 |
Synonyms | LYPLAL1; lysophospholipase-like 1; lysophospholipase-like protein 1; Q96AV0; FLJ99730; KIAA1238; |
Gene ID | 127018 |
mRNA Refseq | NM_138794 |
Protein Refseq | NP_620149 |
MIM | 616548 |
UniProt ID | Q5VWZ2 |
◆ Recombinant Proteins | ||
LYPLAL1-4953C | Recombinant Chicken LYPLAL1 | +Inquiry |
LYPLAL1-2428R | Recombinant Rhesus Macaque LYPLAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPLAL1-3989H | Recombinant Human LYPLAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LYPLAL1-6958H | Recombinant Human Lysophospholipase-Like 1, His-tagged | +Inquiry |
LYPLAL1-6246HF | Recombinant Full Length Human LYPLAL1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPLAL1-4587HCL | Recombinant Human LYPLAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPLAL1 Products
Required fields are marked with *
My Review for All LYPLAL1 Products
Required fields are marked with *