Recombinant Human LYPLAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LYPLAL1-3989H
• Product Overview: LYPLAL1 MS Standard C13 and N15-labeled recombinant protein (NP_620149) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LYPLAL1 (Lysophospholipase Like 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include hydrolase activity and lysophospholipase activity. An important paralog of this gene is LYPLA1.
• Molecular Mass: 26.3 kDa
• AA Sequence: MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LYPLAL1 lysophospholipase-like 1 [ Homo sapiens (human) ]
• Official Symbol: LYPLAL1
• Synonyms: LYPLAL1; lysophospholipase-like 1; lysophospholipase-like protein 1; Q96AV0; FLJ99730; KIAA1238
• Gene ID: 127018
• mRNA Refseq: NM_138794
• Protein Refseq: NP_620149
• MIM: 616548
• UniProt ID: Q5VWZ2