Recombinant Human LYRM4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LYRM4-1777H
• Product Overview: LYRM4 MS Standard C13 and N15-labeled recombinant protein (NP_065141) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis.
• Molecular Mass: 10.7 kDa
• AA Sequence: MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LYRM4 LYR motif containing 4 [ Homo sapiens (human) ]
• Official Symbol: LYRM4
• Synonyms: LYRM4; LYR motif containing 4; C6orf149, chromosome 6 open reading frame 149; LYR motif-containing protein 4; CGI 203; ISD11; homolog of yeast Isd11; mitochondrial matrix Nfs1 interacting protein; CGI-203; C6orf149
• Gene ID: 57128
• mRNA Refseq: NM_020408
• Protein Refseq: NP_065141
• MIM: 613311
• UniProt ID: Q9HD34