Recombinant Human LYRM4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LYRM4-1777H
Product Overview : LYRM4 MS Standard C13 and N15-labeled recombinant protein (NP_065141) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis.
Molecular Mass : 10.7 kDa
AA Sequence : MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LYRM4 LYR motif containing 4 [ Homo sapiens (human) ]
Official Symbol LYRM4
Synonyms LYRM4; LYR motif containing 4; C6orf149, chromosome 6 open reading frame 149; LYR motif-containing protein 4; CGI 203; ISD11; homolog of yeast Isd11; mitochondrial matrix Nfs1 interacting protein; CGI-203; C6orf149;
Gene ID 57128
mRNA Refseq NM_020408
Protein Refseq NP_065141
MIM 613311
UniProt ID Q9HD34

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYRM4 Products

Required fields are marked with *

My Review for All LYRM4 Products

Required fields are marked with *

0
cart-icon
0
compare icon