Recombinant Human LYRM4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LYRM4-1777H |
| Product Overview : | LYRM4 MS Standard C13 and N15-labeled recombinant protein (NP_065141) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. |
| Molecular Mass : | 10.7 kDa |
| AA Sequence : | MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LYRM4 LYR motif containing 4 [ Homo sapiens (human) ] |
| Official Symbol | LYRM4 |
| Synonyms | LYRM4; LYR motif containing 4; C6orf149, chromosome 6 open reading frame 149; LYR motif-containing protein 4; CGI 203; ISD11; homolog of yeast Isd11; mitochondrial matrix Nfs1 interacting protein; CGI-203; C6orf149; |
| Gene ID | 57128 |
| mRNA Refseq | NM_020408 |
| Protein Refseq | NP_065141 |
| MIM | 613311 |
| UniProt ID | Q9HD34 |
| ◆ Recombinant Proteins | ||
| Lyrm4-3881M | Recombinant Mouse Lyrm4 Protein, Myc/DDK-tagged | +Inquiry |
| LYRM4-6032HF | Recombinant Full Length Human LYRM4 Protein, GST-tagged | +Inquiry |
| LYRM4-4228C | Recombinant Chicken LYRM4 | +Inquiry |
| LYRM4-1777H | Recombinant Human LYRM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LYRM4-7574Z | Recombinant Zebrafish LYRM4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYRM4-4584HCL | Recombinant Human LYRM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYRM4 Products
Required fields are marked with *
My Review for All LYRM4 Products
Required fields are marked with *



