Recombinant Human LYRM7 protein, GST-tagged
Cat.No. : | LYRM7-301221H |
Product Overview : | Recombinant Human LYRM7 (1-104 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Gln104 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDIELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage |
Gene Name | LYRM7 LYR motif containing 7 [ Homo sapiens (human) ] |
Official Symbol | LYRM7 |
Synonyms | MZM1L; MC3DN8; C5orf31 |
Gene ID | 90624 |
mRNA Refseq | NM_001293735 |
Protein Refseq | NP_001280664 |
MIM | 615831 |
◆ Recombinant Proteins | ||
LYRM7-301221H | Recombinant Human LYRM7 protein, GST-tagged | +Inquiry |
LYRM7-9403M | Recombinant Mouse LYRM7 Protein | +Inquiry |
LYRM7-5275M | Recombinant Mouse LYRM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYRM7-4538H | Recombinant Human LYRM7 Protein, GST-tagged | +Inquiry |
LYRM7-3176R | Recombinant Rat LYRM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYRM7 Products
Required fields are marked with *
My Review for All LYRM7 Products
Required fields are marked with *