Recombinant Human LYVE1 Protein, His-tagged

• Cat.No.: LYVE1-01H
• Product Overview: Recombinant human LYVE-1 (25-253 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 220
• Description: This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
• Form: Liquid
• Molecular Mass: 23.9 kDa
• AA Sequence: LRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIRKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGG
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: 20mM Tris-HCl buffer (pH 7.5) containing 10% glycerol

Gene Information

• Gene Name: LYVE1 lymphatic vessel endothelial hyaluronan receptor 1 [ Homo sapiens (human) ]
• Official Symbol: LYVE1
• Synonyms: LYVE1; lymphatic vessel endothelial hyaluronan receptor 1; HAR; XLKD1; LYVE-1; CRSBP-1; lymphatic vessel endothelial hyaluronic acid receptor 1; cell surface retention sequence binding protein-1; extracellular link domain-containing 1; extracellular link domain-containing protein 1; hyaluronic acid receptor
• Gene ID: 10894
• mRNA Refseq: NM_006691
• Protein Refseq: NP_006682
• MIM: 605702
• UniProt ID: Q9Y5Y7