Recombinant Human LYVE1 Protein, His-tagged

Cat.No. : LYVE1-01H
Product Overview : Recombinant human LYVE-1 (25-253 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 220
Description : This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
Form : Liquid
Molecular Mass : 23.9 kDa
AA Sequence : LRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIRKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGG
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : 20mM Tris-HCl buffer (pH 7.5) containing 10% glycerol
Gene Name LYVE1 lymphatic vessel endothelial hyaluronan receptor 1 [ Homo sapiens (human) ]
Official Symbol LYVE1
Synonyms LYVE1; lymphatic vessel endothelial hyaluronan receptor 1; HAR; XLKD1; LYVE-1; CRSBP-1; lymphatic vessel endothelial hyaluronic acid receptor 1; cell surface retention sequence binding protein-1; extracellular link domain-containing 1; extracellular link domain-containing protein 1; hyaluronic acid receptor
Gene ID 10894
mRNA Refseq NM_006691
Protein Refseq NP_006682
MIM 605702
UniProt ID Q9Y5Y7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All L Products

Required fields are marked with *

My Review for All L Products

Required fields are marked with *

0
cart-icon