Recombinant Human M6PR, His-tagged
| Cat.No. : | M6PR-29239TH |
| Product Overview : | Recombinant fragment: MFPFYSCWRT GLLLLLLAVA VRESWQTEEK TCDLVGEKGK ESEKELALVK RLKPLFNKSF, corresponding to N terminal amino acids 1-60 of Human Mannose 6 Phosphate Receptor fused to a His tag, 12kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-60 a.a. |
| Description : | This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X. |
| Conjugation : | HIS |
| Form : | Liquid |
| Storage buffer : | Preservative: NoneConstituents: PBS |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSF |
| Gene Name | M6PR mannose-6-phosphate receptor (cation dependent) [ Homo sapiens ] |
| Official Symbol | M6PR |
| Synonyms | M6PR; mannose-6-phosphate receptor (cation dependent); cation-dependent mannose-6-phosphate receptor; |
| Gene ID | 4074 |
| mRNA Refseq | NM_001207024 |
| Protein Refseq | NP_001193953 |
| MIM | 154540 |
| Uniprot ID | P20645 |
| Chromosome Location | 12 |
| Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Lysosome Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
| Function | mannose binding; mannose transmembrane transporter activity; receptor activity; transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| M6PR-5285M | Recombinant Mouse M6PR Protein, His (Fc)-Avi-tagged | +Inquiry |
| M6PR-12413Z | Recombinant Zebrafish M6PR | +Inquiry |
| M6PR-3182R | Recombinant Rat M6PR Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL36045HF | Recombinant Full Length Human Cation-Dependent Mannose-6-Phosphate Receptor(M6Pr) Protein, His-Tagged | +Inquiry |
| M6PR-179H | Recombinant Human M6PR Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| M6PR-398HCL | Recombinant Human M6PR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All M6PR Products
Required fields are marked with *
My Review for All M6PR Products
Required fields are marked with *
