Recombinant Human M6PR, His-tagged
Cat.No. : | M6PR-29239TH |
Product Overview : | Recombinant fragment: MFPFYSCWRT GLLLLLLAVA VRESWQTEEK TCDLVGEKGK ESEKELALVK RLKPLFNKSF, corresponding to N terminal amino acids 1-60 of Human Mannose 6 Phosphate Receptor fused to a His tag, 12kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-60 a.a. |
Description : | This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X. |
Conjugation : | HIS |
Form : | Liquid |
Storage buffer : | Preservative: NoneConstituents: PBS |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSF |
Gene Name | M6PR mannose-6-phosphate receptor (cation dependent) [ Homo sapiens ] |
Official Symbol | M6PR |
Synonyms | M6PR; mannose-6-phosphate receptor (cation dependent); cation-dependent mannose-6-phosphate receptor; |
Gene ID | 4074 |
mRNA Refseq | NM_001207024 |
Protein Refseq | NP_001193953 |
MIM | 154540 |
Uniprot ID | P20645 |
Chromosome Location | 12 |
Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Lysosome Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Function | mannose binding; mannose transmembrane transporter activity; receptor activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
M6PR-2689H | Recombinant Human M6PR protein(31-100 aa), C-His-tagged | +Inquiry |
M6PR-638H | Recombinant Human M6PR, Fc-tagged | +Inquiry |
M6PR-179H | Recombinant Human M6PR Protein, MYC/DDK-tagged | +Inquiry |
M6PR-1335H | Recombinant Human M6PR Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL8095MF | Recombinant Full Length Mouse Cation-Dependent Mannose-6-Phosphate Receptor(M6Pr) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
M6PR-398HCL | Recombinant Human M6PR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All M6PR Products
Required fields are marked with *
My Review for All M6PR Products
Required fields are marked with *
0
Inquiry Basket