Recombinant Human M6PR protein(31-100 aa), C-His-tagged

Cat.No. : M6PR-2689H
Product Overview : Recombinant Human M6PR protein(P20645)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-100 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : TCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
Gene Name M6PR mannose-6-phosphate receptor (cation dependent) [ Homo sapiens ]
Official Symbol M6PR
Synonyms M6PR; mannose-6-phosphate receptor (cation dependent); cation-dependent mannose-6-phosphate receptor; Mr 46,000 Man6PR; CD Man-6-P receptor; small mannose 6-phosphate receptor; 46-kDa mannose 6-phosphate receptor; SMPR; MPR46; CD-MPR; MPR 46; MPR-46; FLJ32994;
Gene ID 4074
mRNA Refseq NM_001207024
Protein Refseq NP_001193953
MIM 154540
UniProt ID P20645

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All M6PR Products

Required fields are marked with *

My Review for All M6PR Products

Required fields are marked with *

0
cart-icon