Recombinant Human M6PR protein(31-100 aa), C-His-tagged
| Cat.No. : | M6PR-2689H |
| Product Overview : | Recombinant Human M6PR protein(P20645)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 31-100 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | TCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE |
| Gene Name | M6PR mannose-6-phosphate receptor (cation dependent) [ Homo sapiens ] |
| Official Symbol | M6PR |
| Synonyms | M6PR; mannose-6-phosphate receptor (cation dependent); cation-dependent mannose-6-phosphate receptor; Mr 46,000 Man6PR; CD Man-6-P receptor; small mannose 6-phosphate receptor; 46-kDa mannose 6-phosphate receptor; SMPR; MPR46; CD-MPR; MPR 46; MPR-46; FLJ32994; |
| Gene ID | 4074 |
| mRNA Refseq | NM_001207024 |
| Protein Refseq | NP_001193953 |
| MIM | 154540 |
| UniProt ID | P20645 |
| ◆ Recombinant Proteins | ||
| M6PR-9420M | Recombinant Mouse M6PR Protein | +Inquiry |
| M6PR-01H | Recombinant Human M6PR Protein, His tagged | +Inquiry |
| M6pr-3888M | Recombinant Mouse M6pr Protein, Myc/DDK-tagged | +Inquiry |
| RFL8095MF | Recombinant Full Length Mouse Cation-Dependent Mannose-6-Phosphate Receptor(M6Pr) Protein, His-Tagged | +Inquiry |
| M6PR-638H | Recombinant Human M6PR, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| M6PR-398HCL | Recombinant Human M6PR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All M6PR Products
Required fields are marked with *
My Review for All M6PR Products
Required fields are marked with *
