Recombinant Human MAFB protein, T7/His-tagged
Cat.No. : | MAFB-218H |
Product Overview : | Recombinant human MAFB (322aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGFAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTR LQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQS FDSFRGAHHHHHHHHPHPHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHATASA TAAGGNGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQL IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | MAFB v-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian) [ Homo sapiens ] |
Official Symbol | MAFB |
Synonyms | MAFB; transcription factor MafB; Kreisler maf-related leucine zipper homolog; KRML; MCTO; MGC43127; |
Gene ID | 9935 |
mRNA Refseq | NM_005461 |
Protein Refseq | NP_005452 |
MIM | 608968 |
UniProt ID | Q9Y5Q3 |
Chromosome Location | 20q11.1-q13.1 |
Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; |
◆ Recombinant Proteins | ||
MAFB-3190R | Recombinant Rat MAFB Protein, His (Fc)-Avi-tagged | +Inquiry |
MAFB-3534R | Recombinant Rat MAFB Protein | +Inquiry |
MAFB-218H | Recombinant Human MAFB protein, T7/His-tagged | +Inquiry |
MAFB-5297M | Recombinant Mouse MAFB Protein, His (Fc)-Avi-tagged | +Inquiry |
MAFB-2547C | Recombinant Chicken MAFB | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAFB-4561HCL | Recombinant Human MAFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAFB Products
Required fields are marked with *
My Review for All MAFB Products
Required fields are marked with *