Recombinant Human MALSU1 Protein, GST-tagged
Cat.No. : | MALSU1-5211H |
Product Overview : | Human C7orf30 full-length ORF ( NP_612455.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MALSU1 (Mitochondrial Assembly Of Ribosomal Large Subunit 1) is a Protein Coding gene. GO annotations related to this gene include ribosomal large subunit binding. |
Molecular Mass : | 52.6 kDa |
AA Sequence : | MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MALSU1 mitochondrial assembly of ribosomal large subunit 1 [ Homo sapiens (human) ] |
Official Symbol | MALSU1 |
Synonyms | C7orf30; MALSU1; mitochondrial assembly of ribosomal large subunit 1; mtRsfA; mitochondrial assembly of ribosomal large subunit protein 1 |
Gene ID | 115416 |
mRNA Refseq | NM_138446 |
Protein Refseq | NP_612455 |
MIM | 614624 |
UniProt ID | Q96EH3 |
◆ Recombinant Proteins | ||
MALSU1-5211H | Recombinant Human MALSU1 Protein, GST-tagged | +Inquiry |
MALSU1-3834HF | Recombinant Full Length Human MALSU1 Protein, GST-tagged | +Inquiry |
Malsu1-3910M | Recombinant Mouse Malsu1 Protein, Myc/DDK-tagged | +Inquiry |
MALSU1-964H | Recombinant Human MALSU1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MALSU1-2635R | Recombinant Rhesus monkey MALSU1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MALSU1-7969HCL | Recombinant Human C7orf30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MALSU1 Products
Required fields are marked with *
My Review for All MALSU1 Products
Required fields are marked with *
0
Inquiry Basket