Recombinant Human MALT1, GST-tagged
| Cat.No. : | MALT1-27H |
| Product Overview : | Recombinant Human MALT1(1 a.a. - 813 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene has been found to be recurrently rearranged in chromosomal translocation with two other genes - baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) and immunoglobulin heavy chain locus - in mucosa-associated lymphoid tissue lymphomas. The protein encoded by this gene may play a role in NF-kappaB activation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Molecular Mass : | 117.5 kDa |
| AA Sequence : | MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLE QCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRA TGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSES KLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD SKKVEIIIDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDL TEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLL DMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDM GKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNV MIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTV CLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVY HSHPGNPSNVTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MALT1 MALT1 paracaspase [ Homo sapiens (human) ] |
| Official Symbol | MALT1 |
| Synonyms | MALT1; mucosa associated lymphoid tissue lymphoma translocation gene 1; MLT; mucosa-associated lymphoid tissue lymphoma translocation protein 1; paracaspase; caspase-like protein; MALT associated translocation; MALT lymphoma-associated translocation; MALT-lymphoma associated translocation; MLT1; DKFZp434L132 |
| Gene ID | 10892 |
| mRNA Refseq | NM_173844 |
| Protein Refseq | NP_776216 |
| MIM | 604860 |
| UniProt ID | Q9UDY8 |
| Chromosome Location | 18q21 |
| Pathway | Activation of NF-kappaB in B cells; B cell receptor signaling pathway; BCR signaling pathway |
| Function | cysteine-type endopeptidase activity; peptidase activity; protein binding |
| ◆ Recombinant Proteins | ||
| MALT1-717H | Recombinant Human MALT1, GST-tagged | +Inquiry |
| MALT1-28H | Recombinant Human MALT1, MYC/DDK-tagged | +Inquiry |
| Malt1-26HCL | Recombinant Mouse Malt1 overexpression lysate | +Inquiry |
| MALT1-2551H | Recombinant Human MALT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MALT1-234H | Recombinant Human MALT1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MALT1-4527HCL | Recombinant Human MALT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MALT1 Products
Required fields are marked with *
My Review for All MALT1 Products
Required fields are marked with *



