Recombinant Human MAPKAP1 protein, His-tagged

• Cat.No.: MAPKAP1-3557H
• Product Overview: Recombinant Human MAPKAP1 protein(1-324 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-324 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGSRAD
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MAPKAP1 mitogen-activated protein kinase associated protein 1 [ Homo sapiens ]
• Official Symbol: MAPKAP1
• Synonyms: MAPKAP1; mitogen-activated protein kinase associated protein 1; target of rapamycin complex 2 subunit MAPKAP1; MGC2745; MIP1; SIN1; stress activated protein kinase interacting 1; mSIN1; TORC2 subunit MAPKAP1; ras inhibitor MGC2745; SAPK-interacting protein 1; MEKK2-interacting protein 1; stress-activated protein kinase-interacting 1; stress-activated map kinase interacting protein 1; stress-activated map kinase-interacting protein 1; mitogen-activated protein kinase 2-associated protein 1; JC310; SIN1b; SIN1g
• Gene ID: 79109
• mRNA Refseq: NM_001006617
• Protein Refseq: NP_001006618
• MIM: 610558
• UniProt ID: Q9BPZ7