Recombinant Human MAPKAP1 protein, His-tagged

Cat.No. : MAPKAP1-3557H
Product Overview : Recombinant Human MAPKAP1 protein(1-324 aa), fused to His tag, was expressed in E. coli.
Availability July 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-324 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGSRAD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MAPKAP1 mitogen-activated protein kinase associated protein 1 [ Homo sapiens ]
Official Symbol MAPKAP1
Synonyms MAPKAP1; mitogen-activated protein kinase associated protein 1; target of rapamycin complex 2 subunit MAPKAP1; MGC2745; MIP1; SIN1; stress activated protein kinase interacting 1; mSIN1; TORC2 subunit MAPKAP1; ras inhibitor MGC2745; SAPK-interacting protein 1; MEKK2-interacting protein 1; stress-activated protein kinase-interacting 1; stress-activated map kinase interacting protein 1; stress-activated map kinase-interacting protein 1; mitogen-activated protein kinase 2-associated protein 1; JC310; SIN1b; SIN1g;
Gene ID 79109
mRNA Refseq NM_001006617
Protein Refseq NP_001006618
MIM 610558
UniProt ID Q9BPZ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPKAP1 Products

Required fields are marked with *

My Review for All MAPKAP1 Products

Required fields are marked with *

0
cart-icon