Recombinant Human MAPKAP1 protein, His-tagged
| Cat.No. : | MAPKAP1-3557H |
| Product Overview : | Recombinant Human MAPKAP1 protein(1-324 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 04, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-324 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGSRAD |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MAPKAP1 mitogen-activated protein kinase associated protein 1 [ Homo sapiens ] |
| Official Symbol | MAPKAP1 |
| Synonyms | MAPKAP1; mitogen-activated protein kinase associated protein 1; target of rapamycin complex 2 subunit MAPKAP1; MGC2745; MIP1; SIN1; stress activated protein kinase interacting 1; mSIN1; TORC2 subunit MAPKAP1; ras inhibitor MGC2745; SAPK-interacting protein 1; MEKK2-interacting protein 1; stress-activated protein kinase-interacting 1; stress-activated map kinase interacting protein 1; stress-activated map kinase-interacting protein 1; mitogen-activated protein kinase 2-associated protein 1; JC310; SIN1b; SIN1g; |
| Gene ID | 79109 |
| mRNA Refseq | NM_001006617 |
| Protein Refseq | NP_001006618 |
| MIM | 610558 |
| UniProt ID | Q9BPZ7 |
| ◆ Recombinant Proteins | ||
| Mapkap1-3949M | Recombinant Mouse Mapkap1 Protein, Myc/DDK-tagged | +Inquiry |
| MAPKAP1-3577R | Recombinant Rat MAPKAP1 Protein | +Inquiry |
| MAPKAP1-3557H | Recombinant Human MAPKAP1 protein, His-tagged | +Inquiry |
| MAPKAP1-1763H | Recombinant Human MAPKAP1 Protein, His&GST-tagged | +Inquiry |
| MAPKAP1-29583TH | Recombinant Human MAPKAP1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAPKAP1-4484HCL | Recombinant Human MAPKAP1 293 Cell Lysate | +Inquiry |
| MAPKAP1-4483HCL | Recombinant Human MAPKAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPKAP1 Products
Required fields are marked with *
My Review for All MAPKAP1 Products
Required fields are marked with *
