"MAPKAPK3" Related Products

Expand
Expand
Expand

Recombinant Human MAPKAPK3 protein, T7-tagged

Cat.No.: MAPKAPK3-167H
Product Overview: Recombinant human MAPKAPK3 (382 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLE CFHRRTGQKCALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMECMEGGELFSRIQERGD QAFTEREAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVA PEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLL KTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNR LLNKRRKKQAGSSSASQGCNNQ
Purity: >90% by SDS-PAGE
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 [ Homo sapiens ]
Official Symbol: MAPKAPK3
Synonyms: MAPKAPK3; 3pK; 3PK; MAPKAP3; MAPKAP kinase 3; chromosome 3p kinase; MAPK-activated protein kinase 3; MK-3; MAPKAP-K3; MAPKAPK-3;
Gene ID: 7867
mRNA Refseq: NM_001243925
Protein Refseq: NP_001230854
MIM: 602130
UniProt ID: Q16644
Chromosome Location: 3p21.3
Pathway: Activated TLR4 signalling, organism-specific biosystem; FAS pathway and Stress induction of HSP regulation, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MAP kinase activation in TLR cascade, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem;
Function: ATP binding; MAP kinase kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity; protein serine/threonine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.