Recombinant Human MAPKAPK3 protein, T7-tagged
Cat.No. : | MAPKAPK3-167H |
Product Overview : | Recombinant human MAPKAPK3 (382 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 382 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLE CFHRRTGQKCALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMECMEGGELFSRIQERGD QAFTEREAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVA PEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLL KTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNR LLNKRRKKQAGSSSASQGCNNQ |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 [ Homo sapiens ] |
Official Symbol | MAPKAPK3 |
Synonyms | MAPKAPK3; 3pK; 3PK; MAPKAP3; MAPKAP kinase 3; chromosome 3p kinase; MAPK-activated protein kinase 3; MK-3; MAPKAP-K3; MAPKAPK-3; |
Gene ID | 7867 |
mRNA Refseq | NM_001243925 |
Protein Refseq | NP_001230854 |
MIM | 602130 |
UniProt ID | Q16644 |
Chromosome Location | 3p21.3 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; FAS pathway and Stress induction of HSP regulation, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MAP kinase activation in TLR cascade, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; |
Function | ATP binding; MAP kinase kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
MAPKAPK3-840H | Active Recombinant Human Mitogen-activated Protein Kinase-activated Protein Kinase 3, GST-tagged | +Inquiry |
MAPKAPK3-1367H | Recombinant Human MAPKAPK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPKAPK3-5011Z | Recombinant Zebrafish MAPKAPK3 | +Inquiry |
MAPKAPK3-9545M | Recombinant Mouse MAPKAPK3 Protein | +Inquiry |
MAPKAPK3-366H | Recombinant Human mitogen-activated protein kinase-activated protein kinase 3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPKAPK3-723HCL | Recombinant Human MAPKAPK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPKAPK3 Products
Required fields are marked with *
My Review for All MAPKAPK3 Products
Required fields are marked with *
0
Inquiry Basket