Recombinant Human MARCH2 Full Length Transmembrane protein, His-SUMO-tagged
| Cat.No. : | MARCH2-2468H |
| Product Overview : | Recombinant Human MARCH2 protein(Q9P0N8)(1-246aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-246aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.0kDa |
| AA Sequence : | MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | MARCH2 membrane-associated ring finger (C3HC4) 2, E3 ubiquitin protein ligase [ Homo sapiens ] |
| Official Symbol | MARCH2 |
| Synonyms | RNF172; HSPC240; MARCH-II |
| Gene ID | 51257 |
| mRNA Refseq | NM_016496.4 |
| Protein Refseq | NP_057580.3 |
| MIM | 613332 |
| UniProt ID | Q9P0N8 |
| ◆ Cell & Tissue Lysates | ||
| MARCH2-4472HCL | Recombinant Human MARCH2 293 Cell Lysate | +Inquiry |
| MARCH2-4474HCL | Recombinant Human MARCH2 293 Cell Lysate | +Inquiry |
| MARCH2-4473HCL | Recombinant Human MARCH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MARCH2 Products
Required fields are marked with *
My Review for All MARCH2 Products
Required fields are marked with *
