Recombinant Human MARCH9 protein, His-tagged
| Cat.No. : | MARCH9-785H | 
| Product Overview : | Recombinant Human MARCH9 protein(265-340 aa), fused with N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 265-340 aa | 
| Tag : | N-His | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. | 
| AA Sequence : | DKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVV | 
| ◆ Recombinant Proteins | ||
| MARCH9-2682R | Recombinant Rhesus monkey MARCH9 Protein, His-tagged | +Inquiry | 
| RFL23180MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase March9(41342) Protein, His-Tagged | +Inquiry | 
| RFL18741HF | Recombinant Full Length Human E3 Ubiquitin-Protein Ligase March9(41342) Protein, His-Tagged | +Inquiry | 
| MARCH9-9562M | Recombinant Mouse MARCH9 Protein | +Inquiry | 
| MARCH9-785H | Recombinant Human MARCH9 protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MARCH9 Products
Required fields are marked with *
My Review for All MARCH9 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            