Recombinant Human MARCKSL1 protein, GST-tagged
Cat.No. : | MARCKSL1-3208H |
Product Overview : | Recombinant Human MARCKSL1 protein(P49006)(1-195aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-195aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MARCKSL1 MARCKS-like 1 [ Homo sapiens ] |
Official Symbol | MARCKSL1 |
Synonyms | MARCKSL1; MARCKS-like 1; MARCKS like protein , MLP; MARCKS-related protein; F52; MacMARCKS; MLP1; mac-MARCKS; MARCKS-like protein 1; macrophage myristoylated alanine-rich C kinase substrate; MLP; MRP; MACMARCKS; |
Gene ID | 65108 |
mRNA Refseq | NM_023009 |
Protein Refseq | NP_075385 |
MIM | 602940 |
UniProt ID | P49006 |
◆ Recombinant Proteins | ||
MARCKSL1-1764H | Recombinant Human MARCKSL1 Protein, His&GST-tagged | +Inquiry |
MARCKSL1-2683R | Recombinant Rhesus monkey MARCKSL1 Protein, His-tagged | +Inquiry |
MARCKSL1-2503R | Recombinant Rhesus Macaque MARCKSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MARCKSL1-3243R | Recombinant Rat MARCKSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MARCKSL1-3208H | Recombinant Human MARCKSL1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCKSL1-4466HCL | Recombinant Human MARCKSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MARCKSL1 Products
Required fields are marked with *
My Review for All MARCKSL1 Products
Required fields are marked with *