Recombinant Human MARCKSL1 protein, GST-tagged
| Cat.No. : | MARCKSL1-3208H | 
| Product Overview : | Recombinant Human MARCKSL1 protein(P49006)(1-195aa), fused to N-terminal GST tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 1-195aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.  | 
                                
| Molecular Mass : | 46.5 kDa | 
| AA Sequence : | MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | MARCKSL1 MARCKS-like 1 [ Homo sapiens ] | 
| Official Symbol | MARCKSL1 | 
| Synonyms | MARCKSL1; MARCKS-like 1; MARCKS like protein , MLP; MARCKS-related protein; F52; MacMARCKS; MLP1; mac-MARCKS; MARCKS-like protein 1; macrophage myristoylated alanine-rich C kinase substrate; MLP; MRP; MACMARCKS; | 
| Gene ID | 65108 | 
| mRNA Refseq | NM_023009 | 
| Protein Refseq | NP_075385 | 
| MIM | 602940 | 
| UniProt ID | P49006 | 
| ◆ Recombinant Proteins | ||
| MARCKSL1-1764H | Recombinant Human MARCKSL1 Protein, His&GST-tagged | +Inquiry | 
| MARCKSL1-2683R | Recombinant Rhesus monkey MARCKSL1 Protein, His-tagged | +Inquiry | 
| MARCKSL1-2503R | Recombinant Rhesus Macaque MARCKSL1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MARCKSL1-3243R | Recombinant Rat MARCKSL1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MARCKSL1-3208H | Recombinant Human MARCKSL1 protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MARCKSL1-4466HCL | Recombinant Human MARCKSL1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All MARCKSL1 Products
Required fields are marked with *
My Review for All MARCKSL1 Products
Required fields are marked with *
  
        
    
      
            