Recombinant Human MASP1, GST-tagged

Cat.No. : MASP1-755H
Product Overview : Recombinant Human MASP1(1 a.a. - 380 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. The encoded protein is synthesized as a zymogen and is activated when it complexes with the pathogen recognition molecules of lectin pathway, the mannose-binding lectin and the ficolins. This protein is not directly involved in complement activation but may play a role as an amplifier of complement activation by cleaving complement C2 or by activating another complement serine protease, MASP-2. The encoded protein is also able to cleave fibrinogen and factor XIII and may may be involved in coagulation. A splice variant of this gene which lacks the serine protease domain functions as an inhibitor of the complement pathway. Alternate splicing results in multiple transcript variants.
Molecular Mass : 70 kDa
AA Sequence : MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEY DYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEE LSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVN LQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNE CPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKKNEIDLESELKS EQVTE
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MASP1 mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) [ Homo sapiens (human) ]
Official Symbol MASP1
Synonyms MASP1; 3MC1; MAP1; MASP; RaRF; CRARF; MASP3; MAp44; PRSS5; CRARF1; mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor); mannan-binding lectin serine protease 1; serine protease 5; complement factor MASP-3; Ra-reactive factor serine protease p100; mannose-binding protein-associated serine protease; mannose-binding lectin-associated serine protease 1; complement-activating component of Ra-reactive factor; EC 3.4.21.-
Gene ID 5648
mRNA Refseq NM_001031849
Protein Refseq NP_001027019
MIM 600521
UniProt ID P48740
Chromosome Location 3q27-q28
Pathway Binding and Uptake of Ligands by Scavenger Receptors; Complement Activation; Complement and coagulation cascades
Function calcium ion binding; calcium-dependent protein binding; peptidase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MASP1 Products

Required fields are marked with *

My Review for All MASP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon