Recombinant Human MASP2 protein, GST-tagged
Cat.No. : | MASP2-45H |
Product Overview : | Recombinant Human MASP2(1 a.a. - 686 a.a.) fused with GST tag at the C-terminus was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-686 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 102.1 kDa |
AA Sequence : | MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYD FVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAP TCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVIL DFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSG RVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQK AKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTH DAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINY IPWIENIISDF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MASP2 mannan-binding lectin serine peptidase 2 [ Homo sapiens ] |
Official Symbol | MASP2 |
Synonyms | MASP2; mannan-binding lectin serine peptidase 2; mannan binding lectin serine peptidase 1 pseudogene 1 , mannan binding lectin serine protease 1 pseudogene 1 , mannan binding lectin serine protease 2 , MASP1P1; mannan-binding lectin serine protease 2; small MBL-associated protein; MBL-associated serine protease 2; MBL-associated plasma protein of 19 kD; mannan-binding lectin serine protease 1 pseudogene 1; mannose-binding protein-associated serine protease 2; mannan-binding lectin serine peptidase 1 pseudogene 1; sMAP; MAP19; MASP-2; MASP1P1; |
Gene ID | 10747 |
mRNA Refseq | NM_006610 |
Protein Refseq | NP_006601 |
MIM | 605102 |
UniProt ID | O00187 |
Chromosome Location | 1p36.3-p36.2 |
Pathway | Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Creation of C4 and C2 activators, organism-specific biosystem; Immune System, organism-specific biosystem; Initial triggering of complement, organism-specific biosystem; |
Function | calcium ion binding; calcium-dependent protein binding; peptidase activity; protein binding; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
Masp2-1446R | Recombinant Rat Masp2 protein, His-tagged | +Inquiry |
MASP2-9577M | Recombinant Mouse MASP2 Protein | +Inquiry |
MASP2-1451H | Recombinant Human MASP2 protein, His-tagged | +Inquiry |
MASP2-5432H | Recombinant Human MASP2 protein, His-tagged | +Inquiry |
MASP2-2171M | Recombinant Mouse MASP2 Protein (20-685 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MASP2-4458HCL | Recombinant Human MASP2 293 Cell Lysate | +Inquiry |
MASP2-4459HCL | Recombinant Human MASP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MASP2 Products
Required fields are marked with *
My Review for All MASP2 Products
Required fields are marked with *
0
Inquiry Basket