"MASP2" Related Products

Expand
Expand

Recombinant Human MASP2 protein, GST-tagged

Cat.No.: MASP2-45H
Product Overview: Recombinant Human MASP2(1 a.a. - 686 a.a.) fused with GST tag at the C-terminus was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 102.1 kDa
AA Sequence: MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYD FVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAP TCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVIL DFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSG RVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQK AKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTH DAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINY IPWIENIISDF
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: MASP2 mannan-binding lectin serine peptidase 2 [ Homo sapiens ]
Official Symbol: MASP2
Synonyms: MASP2; mannan-binding lectin serine peptidase 2; mannan binding lectin serine peptidase 1 pseudogene 1 , mannan binding lectin serine protease 1 pseudogene 1 , mannan binding lectin serine protease 2 , MASP1P1; mannan-binding lectin serine protease 2; small MBL-associated protein; MBL-associated serine protease 2; MBL-associated plasma protein of 19 kD; mannan-binding lectin serine protease 1 pseudogene 1; mannose-binding protein-associated serine protease 2; mannan-binding lectin serine peptidase 1 pseudogene 1; sMAP; MAP19; MASP-2; MASP1P1;
Gene ID: 10747
mRNA Refseq: NM_006610
Protein Refseq: NP_006601
MIM: 605102
UniProt ID: O00187
Chromosome Location: 1p36.3-p36.2
Pathway: Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Creation of C4 and C2 activators, organism-specific biosystem; Immune System, organism-specific biosystem; Initial triggering of complement, organism-specific biosystem;
Function: calcium ion binding; calcium-dependent protein binding; peptidase activity; protein binding; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.