Recombinant Human MASP2 protein, GST-tagged

Cat.No. : MASP2-45H
Product Overview : Recombinant Human MASP2(1 a.a. - 686 a.a.) fused with GST tag at the C-terminus was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-686 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 102.1 kDa
AA Sequence : MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYD FVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAP TCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVIL DFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSG RVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQK AKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTH DAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINY IPWIENIISDF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name MASP2 mannan-binding lectin serine peptidase 2 [ Homo sapiens ]
Official Symbol MASP2
Synonyms MASP2; mannan-binding lectin serine peptidase 2; mannan binding lectin serine peptidase 1 pseudogene 1 , mannan binding lectin serine protease 1 pseudogene 1 , mannan binding lectin serine protease 2 , MASP1P1; mannan-binding lectin serine protease 2; small MBL-associated protein; MBL-associated serine protease 2; MBL-associated plasma protein of 19 kD; mannan-binding lectin serine protease 1 pseudogene 1; mannose-binding protein-associated serine protease 2; mannan-binding lectin serine peptidase 1 pseudogene 1; sMAP; MAP19; MASP-2; MASP1P1;
Gene ID 10747
mRNA Refseq NM_006610
Protein Refseq NP_006601
MIM 605102
UniProt ID O00187
Chromosome Location 1p36.3-p36.2
Pathway Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Creation of C4 and C2 activators, organism-specific biosystem; Immune System, organism-specific biosystem; Initial triggering of complement, organism-specific biosystem;
Function calcium ion binding; calcium-dependent protein binding; peptidase activity; protein binding; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MASP2 Products

Required fields are marked with *

My Review for All MASP2 Products

Required fields are marked with *

0
cart-icon