Recombinant Human MAST4 protein, GST-tagged
Cat.No. : | MAST4-301384H |
Product Overview : | Recombinant Human MAST4 (1-193 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ser193 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSREHQPPPPPPLGGTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDEELDHILSPPPMPFRKCSNPDVASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNPVAGQAWPASAETS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MAST4 microtubule associated serine/threonine kinase family member 4 [ Homo sapiens ] |
Official Symbol | MAST4 |
Synonyms | MAST4; microtubule associated serine/threonine kinase family member 4; microtubule-associated serine/threonine-protein kinase 4; KIAA0303; FLJ16540; FLJ33039; DKFZp686N1467; DKFZp686E18148; |
Gene ID | 375449 |
mRNA Refseq | NM_001164664 |
Protein Refseq | NP_001158136 |
UniProt ID | O15021 |
◆ Recombinant Proteins | ||
Mast4-3967M | Recombinant Mouse Mast4 Protein, Myc/DDK-tagged | +Inquiry |
MAST4-4360H | Recombinant Human MAST4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAST4-301384H | Recombinant Human MAST4 protein, GST-tagged | +Inquiry |
MAST4-5381M | Recombinant Mouse MAST4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAST4-9581M | Recombinant Mouse MAST4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAST4-1009HCL | Recombinant Human MAST4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAST4 Products
Required fields are marked with *
My Review for All MAST4 Products
Required fields are marked with *